Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL2042NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P13850) (1-616aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-616) |
Form : | Lyophilized powder |
AA Sequence : | MDRAVSQVALENDEREAKNTWRLVFRIAILLSTVVTLAISAAALAYSMEASTPSDLVGIP TAISRAEEKITSALGSNQDVVDRIYKQVALESPLALLNTESTIMNAITSLSYRINGAANS SGCGAPIHDPDYIGGIGKELIVDDASDVTSYYPSAFQEHLNFIPAPTTGSGCTRIPSFDM SATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYNSAIPTSMVHGRLGFDGQYHEKDLDVTTLFEDWVANYP GVGGGSFIDNRVWFPVYGGLKPNSPSDTAQEGKYVIYKRYNDTCPDEQDYQIQMAKSSYK PGRFGGKRVQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRVLTVGTSHFLYQRGSSY FSPALLYPMIVSNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDPYPLVFYR NHTLRGVFGTMLDDKQARLNPVSAVFDSISRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKDDGVREARSSRLSQLREGWKDDIVSPIFCDAKN QTEYRRELESYAASWP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P13850 |
◆ Recombinant Proteins | ||
BUB3-2548M | Recombinant Mouse BUB3 Protein | +Inquiry |
IK-3019R | Recombinant Rat IK Protein | +Inquiry |
SCNN1A-7976H | Recombinant Human SCNN1A protein, His & T7-tagged | +Inquiry |
CDK2AP1-27910TH | Recombinant Human CDK2AP1, His-tagged | +Inquiry |
C4B-26130TH | Recombinant Human C4B | +Inquiry |
◆ Native Proteins | ||
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
C1q-07R | Native Rat C1q Protein | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USMG5-476HCL | Recombinant Human USMG5 293 Cell Lysate | +Inquiry |
SEPT6-1956HCL | Recombinant Human SEPT6 293 Cell Lysate | +Inquiry |
GOLGA7-5834HCL | Recombinant Human GOLGA7 293 Cell Lysate | +Inquiry |
GCFC2-8082HCL | Recombinant Human C2orf3 293 Cell Lysate | +Inquiry |
MAOA-4517HCL | Recombinant Human MAOA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket