Recombinant Full Length Nephroselmis Olivacea Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL35847NF |
Product Overview : | Recombinant Full Length Nephroselmis olivacea Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q9TKW4) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nephroselmis olivacea (Green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYEISVFDPSDPVLNPMWRQGM FVIPFMTRLGVTKSWGGWSITGESVSNPGIWSYEGVATAHILLSGALFMAAIWHWVFWDL ELFRDPRTGEPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLYGPGIWVSDPYGITGSVQP VEPAWGPEGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDQGFFQQEIEKRVQGSLASGASLSD AWAKIPEKLSFYDYIGNNPAKGGLFRAGAMNSGDGIAAGWLGHPVFTDKAGNELFVRRMP TFFETFPVLLVDKDGVVRADVPFRRAESKYSIEQVGVSVTFYGGELDGVTFNDPSTVKKY ARRAQLGSVFEFDRATLQSDGVFRSSPRGWFTFGHLWFALLFFFGHIWHGARTIFRDVFG GIDPDLDDQVEFGAFQKLGDVTTRRQAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q9TKW4 |
◆ Recombinant Proteins | ||
SHE-8148M | Recombinant Mouse SHE Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHL2-558H | Recombinant Human KLHL2, GST tagged | +Inquiry |
ERBB2-171CAF555 | Recombinant Canine ERBB2 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
NECTIN2-1179H | Recombinant Human NECTIN2 Protein (Gln32-Pro350), N-His tagged | +Inquiry |
CHL1-1975M | Recombinant Mouse CHL1 protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
HBA2-27784TH | Native Human HBA2 | +Inquiry |
F10-9H | Native Human Factor Xa, Active Site Labeled with Biotin | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTX2-3511HCL | Recombinant Human OTX2 293 Cell Lysate | +Inquiry |
GBP4-5998HCL | Recombinant Human GBP4 293 Cell Lysate | +Inquiry |
USP2-468HCL | Recombinant Human USP2 293 Cell Lysate | +Inquiry |
TRAPPC2L-808HCL | Recombinant Human TRAPPC2L 293 Cell Lysate | +Inquiry |
KARS-5090HCL | Recombinant Human KARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket