Recombinant Full Length Populus Alba Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL6958PF |
Product Overview : | Recombinant Full Length Populus alba Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q14FD1) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Populus alba (White poplar) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPLFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q14FD1 |
◆ Recombinant Proteins | ||
NME8-5581Z | Recombinant Zebrafish NME8 | +Inquiry |
CHMP2A-27958TH | Recombinant Human CHMP2A, His-tagged | +Inquiry |
TMED7-12165Z | Recombinant Zebrafish TMED7 | +Inquiry |
ATP1A1-399H | Recombinant Human ATP1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD160-1305H | Recombinant Human CD160 Protein (Gly37-Asn154), N-His tagged | +Inquiry |
◆ Native Proteins | ||
Laminin-33H | Native Human Laminin protein | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
PLD-16C | Active Native cabbage Phospholipase D, Type IV | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
MYH-10B | Active Native Bovine Myosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10RA-1185CCL | Recombinant Cynomolgus IL10RA cell lysate | +Inquiry |
RDH14-2436HCL | Recombinant Human RDH14 293 Cell Lysate | +Inquiry |
FOXRED2-6140HCL | Recombinant Human FOXRED2 293 Cell Lysate | +Inquiry |
NHLH1-3833HCL | Recombinant Human NHLH1 293 Cell Lysate | +Inquiry |
Hippocampus-239R | Rhesus monkey Hippocampus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket