Recombinant Full Length Mycoplasma Genitalium Uncharacterized Protein Mg147 (Mg147) Protein, His-Tagged
Cat.No. : | RFL18575MF |
Product Overview : | Recombinant Full Length Mycoplasma genitalium Uncharacterized protein MG147 (MG147) Protein (P47393) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma genitalium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MLLLRALFLELKTNKNCKALLLLLIPLLVGLTLIIYGIVLFSTEGVIDHGDHNHLRARFQ LTLEEIIVFVVGSIILFFTLASFCVSCFMLMRSPKQKQLEVDHANKTNLKPKAIVNCDLF QLGDYCVFTFKKLSFKQRFKQDFFARSKFSFRSELYRLCLVGVLIALNLALSLIEIPGIV LPWGSSIQFRFFNTAILFIAVRLVGLLSTSLVALITPWLHLLIHPIHTPISSLFYMVNDF LVLWIFYFFFFHLFKAEVNQTTTVVDNKPFSQLVNTKKTKWTKFFSLLVISFLCGFIEGL GFYFGYFLILGNVSSLGLKIYYDGLQQRDLINSSNVLFFLMTTTAIFSIKYIFEMLFFFS VEKNVVNIANHFGLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MG147 |
Synonyms | MG147; Uncharacterized protein MG147 |
UniProt ID | P47393 |
◆ Recombinant Proteins | ||
STK3-4527R | Recombinant Rhesus monkey STK3 Protein, His-tagged | +Inquiry |
IL4R-331H | Recombinant Human IL4R Protein, His-tagged | +Inquiry |
TSC2-6386Z | Recombinant Zebrafish TSC2 | +Inquiry |
RFL35147SF | Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Membrane Protein Yhl071W (Yhl017W) Protein, His-Tagged | +Inquiry |
SLAMF6-269H | Recombinant Human SLAMF6, Fc tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
IGHA2 -19H | Native Human IgA2 | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SkeletalMuscles-543E | Equine Skeletal Muscles Lysate, Total Protein | +Inquiry |
NAP1L1-3978HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
RNF168-1520HCL | Recombinant Human RNF168 cell lysate | +Inquiry |
PIGP-3195HCL | Recombinant Human PIGP 293 Cell Lysate | +Inquiry |
HSD17B4-5373HCL | Recombinant Human HSD17B4 293 Cell Lysate | +Inquiry |
|
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MG147 Products
Required fields are marked with *
My Review for All MG147 Products
Required fields are marked with *
0
Inquiry Basket