Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Membrane Protein Yhl071W (Yhl017W) Protein, His-Tagged
Cat.No. : | RFL35147SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized membrane protein YHL071W (YHL017W) Protein (P38745) (21-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-532) |
Form : | Lyophilized powder |
AA Sequence : | NQESINQKYHDVCSGMYSKEDFNGKVDPYISFTLEELSLADEDDDGEGVSVAVFDFQDYE HIGVRLPNGEIQYICDDYALDLGLCEDSSEGQFIIQETAIDPFTSKEHKLTSQILTFTQQ ELGTNDKVYSINKTGYYCVTTSSFISSSSKFKATVNFRNAYGQLDASEAYKMPIYAFLAV AYAVCTLVYSWLCWKHRHELLPLQRYILVFCIFLTADTIFVWMYYIIENQKGNSSVALHV YMVFISIFSAGKMTFTLLLALLISLGYGIVYPKLDRTLLRRCQIFAIFTFAVCVAFLVQK YSQNSESLSNLILITAIPLVLCLFAFYYLTLSSMNKTMTYLREQNQVVKLNMYRKLIILC YISLFILFLGLLVSTFAYVGMDTVDMIEQYWKTEFLITDTWPSFVYFLVFVIFAFFWRPT STSYLLACSHQLPTDMENVSEFDLDDINSLSDEALPNREPRNDYQEHDHNMDIDLASDFE EVPSVNANTNANNDVLFDVDYDRDAKNDRSTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YHL017W |
Synonyms | YHL017W; Uncharacterized membrane protein YHL071W |
UniProt ID | P38745 |
◆ Recombinant Proteins | ||
ARL11-716M | Recombinant Mouse ARL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mme-1793R | Recombinant Rat Mme protein, His-tagged | +Inquiry |
RFL13883SF | Recombinant Full Length Streptococcus Thermophilus Protease Htpx Homolog(Htpx) Protein, His-Tagged | +Inquiry |
CD8A-132H | Recombinant Human CD8A Protein, His-tagged | +Inquiry |
GPBP1L1-1749R | Recombinant Rhesus Macaque GPBP1L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
HBA2-27784TH | Native Human HBA2 | +Inquiry |
ELANE-8104H | Native Human Neutrophil Elastase | +Inquiry |
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A4A-4124HCL | Recombinant Human MS4A4A 293 Cell Lysate | +Inquiry |
ELK4-6627HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
PPP1R3C-2934HCL | Recombinant Human PPP1R3C 293 Cell Lysate | +Inquiry |
LGALS2-4767HCL | Recombinant Human LGALS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YHL017W Products
Required fields are marked with *
My Review for All YHL017W Products
Required fields are marked with *
0
Inquiry Basket