Recombinant Full Length Mycoplasma Genitalium Ribonuclease Y(Rny) Protein, His-Tagged
Cat.No. : | RFL26521MF |
Product Overview : | Recombinant Full Length Mycoplasma genitalium Ribonuclease Y(rny) Protein (P47376) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma genitalium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MNNNITNSIAQLFFNTSFFAFLFLIIIAFNLCLFAYLYFQYRIYKKNPKKANNFKANEYE KIKLLKNQNFTESNKLIATTNELNELTSQLDNILVRIINKPLAKLVNDFLDEQIKQIVKL DKNSSDFHSESDNLPFYTKLFNDFHFGVDKLININIKNPLYNWVYSPSFLISESDFRKLN GISGINKKLLVEKLRIEDIVFTDLNKKYEVNVLTESPIKAQKTVLTVRNILMNDYVDNER IESYVQQANFFFTEHCKKIGKEILESLNIFISSSSLHRHFGFLAFRYSFGQNVLSHSLET AFLTAHLAALIELDSELSLKCGLLHDIGKSNDDNGKESHTITGAKLAEQFQLPDDIKYTI ANHHNKHIDNTYCRLTQIADKLSAARIGARSDSSLLFKQLKDELKKIVDKTINNFHTTIL LGQSGRRLMIWLETKNQNQLLSNEQIIEMVEKIKAEIAKNPITNHFPIKVVIRYNFEHSF NTKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rny |
Synonyms | rny; MG130; Ribonuclease Y; RNase Y |
UniProt ID | P47376 |
◆ Recombinant Proteins | ||
TMEM175-5858Z | Recombinant Zebrafish TMEM175 | +Inquiry |
CCL15-492H | Recombinant Human CCL15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAMK1-763R | Recombinant Rat CAMK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ifit2-1216M | Recombinant Mouse Ifit2 Protein, MYC/DDK-tagged | +Inquiry |
HAVCR2-01H | Active Recombinant Human HAVCR2 Protein, Fc-Tagged | +Inquiry |
◆ Native Proteins | ||
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVRL1-2299HCL | Recombinant Human PVRL1 cell lysate | +Inquiry |
DCLK1-435HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
LCN9-4797HCL | Recombinant Human LCN9 293 Cell Lysate | +Inquiry |
SIRT5-1830HCL | Recombinant Human SIRT5 293 Cell Lysate | +Inquiry |
LAMA3-4828HCL | Recombinant Human LAMA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rny Products
Required fields are marked with *
My Review for All rny Products
Required fields are marked with *
0
Inquiry Basket