Recombinant Human CCL15 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CCL15-492H
Product Overview : CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_116740) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14).
Molecular Mass : 12.7 kDa
AA Sequence : MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CCL15 C-C motif chemokine ligand 15 [ Homo sapiens (human) ]
Official Symbol CCL15
Synonyms CCL15; chemokine (C-C motif) ligand 15; SCYA15, small inducible cytokine subfamily A (Cys Cys), member 15; C-C motif chemokine 15; CC chemokine 3; chemokine CC 2; HCC 2; HMRP 2B; leukotactin 1; Lkn 1; macrophage inflammatory protein 5; MIP 1 delta; MIP 1d; MIP 5; NCC 3; SCYL3; MIP-1 delta; chemokine CC-2; new CC chemokine 3; small-inducible cytokine A15; small inducible cytokine subfamily A (Cys-Cys), member 15; LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; MIP-1D; MRP-2B; SCYA15; HMRP-2B;
Gene ID 6359
mRNA Refseq NM_032964
Protein Refseq NP_116740
MIM 601393
UniProt ID Q16663

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL15 Products

Required fields are marked with *

My Review for All CCL15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon