Recombinant Full Length Mycoplasma Genitalium Oligopeptide Transport System Permease Protein Oppb(Oppb) Protein, His-Tagged
Cat.No. : | RFL8414MF |
Product Overview : | Recombinant Full Length Mycoplasma genitalium Oligopeptide transport system permease protein oppB(oppB) Protein (P47323) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma genitalium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MFKYILKRLGLAVVAMFIVMSIVFFLVNATGNVPLSATSARDIAAVQAQLQEFGFNDPII VRYFRYWAKLFSFQADALGIYYANPNQTIGEIVFARVPNTLYVVLISFLIGSLLGIFLGM VSGLNRGKFLDAAINVLVVLFVSIPSFVVGLGLLKLAGFLNLPPRFINFDDAFFSFDRFL LASIIPILSLVFYSSAAFTYRIRNEVVEVMNQDYIKTAKSKGLGMFAVARYHIFRNSIIP SIPLFVFGISGAFSGGFIIESLFGVQGVSRILIDSVQVNETNMVMFNILFIQGIPLLASV FIEFIYVLVDPRIRIANSSNVSLLTKLKFLSSRHQWLMKWNKINSDNAQNIVFNSPLHHQ LLELNAIDYKTKTVQLTTEQKTALNISATANFILLGNKCLKLKTIHG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | oppB |
Synonyms | oppB; MG077; Oligopeptide transport system permease protein OppB |
UniProt ID | P47323 |
◆ Native Proteins | ||
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
IgG-152R | Native Rat IgG Fab fragment | +Inquiry |
Lectin-1862W | Active Native Wheat Germ Agglutinin Protein, Rhodamine labeled | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDHD1A-5596HCL | Recombinant Human HDHD1A 293 Cell Lysate | +Inquiry |
FLJ40504-6188HCL | Recombinant Human FLJ40504 293 Cell Lysate | +Inquiry |
CCT8-7686HCL | Recombinant Human CCT8 293 Cell Lysate | +Inquiry |
SULT4A1-1347HCL | Recombinant Human SULT4A1 293 Cell Lysate | +Inquiry |
ELMOD1-6620HCL | Recombinant Human ELMOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All oppB Products
Required fields are marked with *
My Review for All oppB Products
Required fields are marked with *
0
Inquiry Basket