Recombinant Full Length Lactococcus Lactis Subsp. Cremoris Oligopeptide Transport System Permease Protein Oppb(Oppb) Protein, His-Tagged
Cat.No. : | RFL5630LF |
Product Overview : | Recombinant Full Length Lactococcus lactis subsp. cremoris Oligopeptide transport system permease protein oppB(oppB) Protein (P0A4N8) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactococcus lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MWKVIIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDP WWEQYLRWLGNAIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVA ARNEGKWQDQLWLTYNSITFGIPPYVFYLLIIFIFGYSLNWFPTGGTVSPDAMGIIPVFF SKIYHMILPAFSLAVFGTVGIFTYFRSGILDEQTQDYVRTARAKGVKEKVIFRRHILRNA SLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRDYSMITALILLNGFLGLL GALLSDIIMAMVDPRIRIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | oppB |
Synonyms | oppB; LACR_D19; Oligopeptide transport system permease protein OppB |
UniProt ID | P0A4N8 |
◆ Recombinant Proteins | ||
AARS2-1114H | Recombinant Human AARS2 | +Inquiry |
RFL28266LF | Recombinant Full Length Lactobacillus Plantarum Glycerol Uptake Facilitator Protein-Like 5(Glpf5) Protein, Tag-Free | +Inquiry |
NAP1L5-2945R | Recombinant Rhesus monkey NAP1L5 Protein, His-tagged | +Inquiry |
CD27-572H | Recombinant Human CD27 protein, His-tagged | +Inquiry |
IL7R-2260H | Recombinant Human IL7R protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-30083TH | Native Human PLG | +Inquiry |
Ferritin-12H | Native Human Ferritin Protein, Tag Free | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS19-2379HCL | Recombinant Human RGS19 293 Cell Lysate | +Inquiry |
LINC00482-8236HCL | Recombinant Human C17orf55 293 Cell Lysate | +Inquiry |
Uterus-808G | Guinea Pig Uterus Membrane Lysate, Total Protein | +Inquiry |
SLITRK6-1390HCL | Recombinant Human SLITRK6 cell lysate | +Inquiry |
Adrenal-10H | Human Adrenal Lupus Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All oppB Products
Required fields are marked with *
My Review for All oppB Products
Required fields are marked with *
0
Inquiry Basket