Recombinant Full Length Mycoplasma Pneumoniae Oligopeptide Transport System Permease Protein Oppb(Oppb) Protein, His-Tagged
Cat.No. : | RFL31349MF |
Product Overview : | Recombinant Full Length Mycoplasma pneumoniae Oligopeptide transport system permease protein oppB(oppB) Protein (P75554) (1-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycoplasma Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-389) |
Form : | Lyophilized powder |
AA Sequence : | MFIVMTIVFFLVNSTGQTPLSATSSKDLEAVKTQLDAFGFNDPLIVRYGRYWQTLFSGSL GTYYSSPNQTIDQIVFGRVPNTLYVVLISFFIGSLLGIIFGMISGLFRGKLIDAVINVLV VLFVSIPSFVVGLGLLKAAGLFRLPPRFINFDDANFNFGNFLLASIIPILSLVFYTSAAF TYRVRNEVVEVMNQDYIKTARSKGLSTFAVALYHIFRNSIIPSVPLFVFGISGAFSGGFI IESLFGVQGVSRILIDSVQSNETNLVMFNIMFIQGIPLLASVFIELIYVLVDPRIRIASA GGVSLWTKLKFVYLRQAWLRKWRRINHTNSHNVLFNSPQHRQLLELKAIDYKHNTISLTE QQKTTLKIEPTANFVLLGTKCLKIITIHG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | oppB |
Synonyms | oppB; MPN_215; MP616; Oligopeptide transport system permease protein OppB |
UniProt ID | P75554 |
◆ Recombinant Proteins | ||
Cd80-37M | Recombinant Mouse CD80 Protein (ECD), His-tagged(C-ter) | +Inquiry |
GATA4-535H | Recombinant Human GATA4 Protein, His-tagged | +Inquiry |
DTPT-2129B | Recombinant Bacillus subtilis DTPT protein, His-tagged | +Inquiry |
CHD1L-3377M | Recombinant Mouse CHD1L Protein | +Inquiry |
RFL2622XF | Recombinant Full Length Xenopus Laevis Mitochondrial Inner Membrane Protease Subunit 2(Immp2L) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MUC1-376H | Active Native Human MUC1 | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
ACTB-325H | Active Native Human ACTB | +Inquiry |
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
Lectin-1749G | Active Native Galanthus Nivalis Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA5&ITGB6-854HCL | Recombinant Human ITGA5&ITGB6 cell lysate | +Inquiry |
MLYCD-1119HCL | Recombinant Human MLYCD cell lysate | +Inquiry |
KCTD7-895HCL | Recombinant Human KCTD7 cell lysate | +Inquiry |
RILPL2-2339HCL | Recombinant Human RILPL2 293 Cell Lysate | +Inquiry |
PTPN2-567HCL | Recombinant Human PTPN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All oppB Products
Required fields are marked with *
My Review for All oppB Products
Required fields are marked with *
0
Inquiry Basket