Recombinant Full Length Haemophilus Influenzae Oligopeptide Transport System Permease Protein Oppb(Oppb) Protein, His-Tagged
Cat.No. : | RFL12123HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Oligopeptide transport system permease protein oppB(oppB) Protein (P45054) (1-306aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-306) |
Form : | Lyophilized powder |
AA Sequence : | MLKFIFKRLLEALPTLFILITFSFFLMRLAPGSPFTSERAYPPEVMANIEAKYHLNEPLY KQYFLYLENLSKGDFGPSFKYKDQSVNDLIASAFPVSIKLGMVAFAFAVVLGVTAGTLAA LNQNSRWDYILMSFSMLGVIMPSFVFAPVLVLIFAIYLGWLPAGGWNGGTAMYMILPVAS LTIAYVAGIARIMRGSMIEVLHSNFIRTAKAKGLSMSRIILKHALRPALLPVITYLGPAF VGIITGSMVIESVFGLPGMGLLFVNGALNRDYSLVLSLTILVGTLTILFNAIVDILYAII DPKIRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | oppB |
Synonyms | oppB; HI_1123; Oligopeptide transport system permease protein OppB |
UniProt ID | P45054 |
◆ Recombinant Proteins | ||
VIPR1-1045HFL | Recombinant Human VIPR1 protein, His&Flag-tagged | +Inquiry |
4b-3263V | Recombinant Human parainfluenza virus 4b(HPIV-4b) 4b protein(Ser48-The579), His-tagged | +Inquiry |
SNX3-5161H | Recombinant Human SNX3 protein, GST-tagged | +Inquiry |
MRPS28-4865Z | Recombinant Zebrafish MRPS28 | +Inquiry |
FNIP1-6788Z | Recombinant Zebrafish FNIP1 | +Inquiry |
◆ Native Proteins | ||
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
IgG-352G | Native HAMSTER IgG | +Inquiry |
ALB-8301S | Native Sheep ALB | +Inquiry |
Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
◆ Cell & Tissue Lysates | ||
COG8-7381HCL | Recombinant Human COG8 293 Cell Lysate | +Inquiry |
NUDCD3-3657HCL | Recombinant Human NUDCD3 293 Cell Lysate | +Inquiry |
PRPS1L1-504HCL | Recombinant Human PRPS1L1 lysate | +Inquiry |
Pancreas-660G | Guinea Pig Pancreas Lysate, Total Protein | +Inquiry |
TRIM60-1831HCL | Recombinant Human TRIM60 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All oppB Products
Required fields are marked with *
My Review for All oppB Products
Required fields are marked with *
0
Inquiry Basket