Recombinant Full Length Human Coronavirus Hku1 Hemagglutinin-Esterase(He) Protein, His-Tagged
Cat.No. : | RFL30327HF |
Product Overview : | Recombinant Full Length Human coronavirus HKU1 Hemagglutinin-esterase(HE) Protein (Q5MQD1) (14-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HCoV-HKU1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (14-386) |
Form : | Lyophilized powder |
AA Sequence : | FNEPLNVVSHLNHDWFLFGDSRSDCNHINNLKIKNFDYLDIHPSLCNNGKISSSAGDSIF KSFHFTRFYNYTGEGDQIIFYEGVNFNPYHRFKCFPNGSNDVWLLNKVRFYRALYSNMAF FRYLTFVDIPYNVSLSKFNSCKSDILSLNNPIFINYSKEVYFTLLGCSLYLVPLCLFKSN FSQYYYNIDTGSVYGFSNVVYPDLDCIYISLKPGSYKVSTTAPFLSLPTKALCFDKSKQF VPVQVVDSRWNNERASDISLSVACQLPYCYFRNSSANYVGKYDINHGDSGFISILSGLLY NVSCISYYGVFLYDNFTSIWPYYSFGRCPTSSIIKHPICVYDFLPIILQGILLCLALLFV VFLLFLLYNDKSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HE |
Synonyms | HE; 2; Hemagglutinin-esterase; HE protein; E3 glycoprotein |
UniProt ID | Q5MQD1 |
◆ Recombinant Proteins | ||
WISP3-18557M | Recombinant Mouse WISP3 Protein | +Inquiry |
BBS2-1585HF | Recombinant Full Length Human BBS2 Protein, GST-tagged | +Inquiry |
RFL27532SF | Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Yal065C (Yal065C) Protein, His-Tagged | +Inquiry |
Pfs25-03P | Recombinant Plasmodium falciparum Pfs25 Antigen, C-6×His tagged | +Inquiry |
CXCL2-2165P | Recombinant CXCL2 Protein, His-Flag-StrepII-tagged | +Inquiry |
◆ Native Proteins | ||
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
KRT18-173B | Native bovine KRT18 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED29-1074HCL | Recombinant Human MED29 cell lysate | +Inquiry |
SERPINA6-1948HCL | Recombinant Human SERPINA6 cell lysate | +Inquiry |
C14orf142-8287HCL | Recombinant Human C14orf142 293 Cell Lysate | +Inquiry |
DHRS1-6941HCL | Recombinant Human DHRS1 293 Cell Lysate | +Inquiry |
OVCAR3-052WCY | Human Ovarian Adenocarcinoma OVCAR3 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HE Products
Required fields are marked with *
My Review for All HE Products
Required fields are marked with *
0
Inquiry Basket