Recombinant Full Length Mouse Tumor Necrosis Factor Ligand Superfamily Member 12(Tnfsf12) Protein, His-Tagged
Cat.No. : | RFL22909MF |
Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor ligand superfamily member 12(Tnfsf12) Protein (O54907) (1-249aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-249) |
Form : | Lyophilized powder |
AA Sequence : | MAARRSQRRRGRRGEPGTALLAPLVLSLGLALACLGLLLVVVSLGSWATLSAQEPSQEELTAEDRREPPELNPQTEESQDVVPFLEQLVRPRRSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tnfsf12 |
Synonyms | Tnfsf12; Tumor necrosis factor ligand superfamily member 12; TNF-related weak inducer of apoptosis; TWEAK |
UniProt ID | O54907 |
◆ Recombinant Proteins | ||
TNFSF12-8822C | Recombinant Cynomolgus TNFSF12, Fc tagged | +Inquiry |
TNFSF12-4872R | Recombinant Rhesus monkey TNFSF12 Protein, His-tagged | +Inquiry |
ABHD3-9241H | Recombinant Human ABHD3 protein, His-tagged | +Inquiry |
TNFSF12-9483M | Recombinant Mouse TNFSF12 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF12-565H | Active Recombinant Human TNFSF12 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF12-1204RCL | Recombinant Rat TNFSF12 cell lysate | +Inquiry |
TNFSF12-1155CCL | Recombinant Cynomolgus TNFSF12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnfsf12 Products
Required fields are marked with *
My Review for All Tnfsf12 Products
Required fields are marked with *
0
Inquiry Basket