Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 12(Tnfsf12) Protein, His-Tagged

• Cat.No.: RFL27494HF
• Product Overview: Recombinant Full Length Human Tumor necrosis factor ligand superfamily member 12(TNFSF12) Protein (O43508) (1-249aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Full Length (1-249)
• Form: Lyophilized powder
• AA Sequence: MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: TNFSF12
• Synonyms: APO 3 ligand; APO 3L; APO3 ligand; APO3/DR3 ligand; APO3L; DR3LG; MGC129581; MGC20669; secreted form; TNF-related weak inducer of apoptosis; TNF12_HUMAN; TNFSF 12; Tnfsf12; TNFSF12 protein; Tumor necrosis factor (ligand) superfamily member 12; Tumor necro
• UniProt ID: O43508