Recombinant Full Length Mouse Protein Fam26D(Fam26D) Protein, His-Tagged
Cat.No. : | RFL8539MF |
Product Overview : | Recombinant Full Length Mouse Protein FAM26D(Fam26d) Protein (Q8CE93) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MSPDLNCISSSLLRSEPCINSLIAILTVCGQQLFSSYTFSCPCQVGKNFYYGSAFLVVPA LILLIAGYALRGQMWTVASEYCCCSCTPPYRRSSPLERRLACLMFFDITGRALVAPLTWL TVTLLTGTYYECAASEFASVDQYPMFANVTPSKREEMLAGFPCYTSAPSDVIPIRDEVAL LHRYQSQMLGWILVVLATIALLLSKCLARCCSPLTSLQHHYWTNHLHNERVLFEKAAEEH SQLLIRHRIKKVFGFVPGSEDIKHIRIPSCQDWREISVPNLLCVGDTSQGPYSFLGDRVV EENEEDRQEGIEMKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Calhm4 |
Synonyms | Calhm4; Fam26d; Calcium homeostasis modulator protein 4; Protein FAM26D |
UniProt ID | Q8CE93 |
◆ Recombinant Proteins | ||
MYO19-5856M | Recombinant Mouse MYO19 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDYL-1322R | Recombinant Rat CDYL Protein | +Inquiry |
HA-3355V | Recombinant Influenza A H1N1 (A/Guangdong-Maonan/SWL1536/2019) HA protein(Met1-Ile530), His-tagged | +Inquiry |
FAM129A-2980M | Recombinant Mouse FAM129A Protein, His (Fc)-Avi-tagged | +Inquiry |
N4BP2L2-3534R | Recombinant Rat N4BP2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
ZNF488-65HCL | Recombinant Human ZNF488 293 Cell Lysate | +Inquiry |
NLRP2-3800HCL | Recombinant Human NLRP2 293 Cell Lysate | +Inquiry |
CD109-314HCL | Recombinant Human CD109 cell lysate | +Inquiry |
AOC3-85HCL | Recombinant Human AOC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Calhm4 Products
Required fields are marked with *
My Review for All Calhm4 Products
Required fields are marked with *
0
Inquiry Basket