Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 153(Gpr153) Protein, His-Tagged
Cat.No. : | RFL33436MF |
Product Overview : | Recombinant Full Length Mouse Probable G-protein coupled receptor 153(Gpr153) Protein (Q8K0Z9) (1-631aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-631) |
Form : | Lyophilized powder |
AA Sequence : | MSDERRLPSSAVGWLACGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVP IATYAVVQLRRQRPDYEWNEGLCKVFVSTFYTLTLATCFSVTSISYHRMWMVRWPVNYRL SNAKKQAVHTVMGIWMVSFILSALPAVGWHDTSERFYTHGCRFIVAEIGLGFGVCFLLLV GGSVAMGMVCTAIALFQTLATQVGHRADRRTFTVPTIVVEDAQGKRRSSIDGSEPARTSL QITGLVATIVVIYDCLMGFPVLVVSFSSLRADASAPWMALCVLWCSVTQALLLPLFLWTC DRYRADLKAVWEKCVALMANDEDSDNETSLEGSISPDMVLERSLDYSYGGDFVALDRMAK YELSALEGGLPQLYPLRPLQEDRMQYLQGAGRHRCGFPGGQPCFSPAGCSQVPPTRRFSH DDADVWAAVPLPTFLPRWSSGEDLAALAHLMLPAGSDRRRGSLLAFAEDAPPFRPRRRSA ESLLSLQPSSLDGGPRHAQDSPPGSPRRRPGPGARSASVSLLPDAFALTAFEREPQALRR VPAPAQPFPAARDSAEPAEVPTPPGGRTQRSQGRRAARTHVGPLQSSLSASWGEPGGLHA AGCGSISSFLSSPSESSGYVTLHSDSLGSAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr153 |
Synonyms | Gpr153; Pgr1; Probable G-protein coupled receptor 153; G-protein coupled receptor PGR1 |
UniProt ID | Q8K0Z9 |
◆ Recombinant Proteins | ||
SMAD6-8458M | Recombinant Mouse SMAD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
VIM-1086C | Recombinant Cynomolgus VIM Protein, His-tagged | +Inquiry |
LTBR-190H | Recombinant Human LTBR protein, Fc-tagged | +Inquiry |
GPR17-13460H | Recombinant Human GPR17, GST-tagged | +Inquiry |
RS1-4040R | Recombinant Rhesus monkey RS1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
LDL-243H | Native Human Lipoproteins, Intermediate Density | +Inquiry |
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
FGA-30B | Native Bovine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCYOX1L-1318HCL | Recombinant Human PCYOX1L cell lysate | +Inquiry |
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
NIT1-3824HCL | Recombinant Human NIT1 293 Cell Lysate | +Inquiry |
T24-90HL | Human T24 lysate | +Inquiry |
IL17C-5243HCL | Recombinant Human IL17C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpr153 Products
Required fields are marked with *
My Review for All Gpr153 Products
Required fields are marked with *
0
Inquiry Basket