Recombinant Full Length Human Probable G-Protein Coupled Receptor 153(Gpr153) Protein, His-Tagged
Cat.No. : | RFL32632HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 153(GPR153) Protein (Q6NV75) (1-609aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-609) |
Form : | Lyophilized powder |
AA Sequence : | MSDERRLPGSAVGWLVCGGLSLLANAWGILSVGAKQKKWKPLEFLLCTLAATHMLNVAVP IATYSVVQLRRQRPDFEWNEGLCKVFVSTFYTLTLATCFSVTSLSYHRMWMVCWPVNYRL SNAKKQAVHTVMGIWMVSFILSALPAVGWHDTSERFYTHGCRFIVAEIGLGFGVCFLLLV GGSVAMGVICTAIALFQTLAVQVGRQADRRAFTVPTIVVEDAQGKRRSSIDGSEPAKTSL QTTGLVTTIVFIYDCLMGFPVLVVSFSSLRADASAPWMALCVLWCSVAQALLLPVFLWAC DRYRADLKAVREKCMALMANDEESDDETSLEGGISPDLVLERSLDYGYGGDFVALDRMAK YEISALEGGLPQLYPLRPLQEDKMQYLQVPPTRRFSHDDADVWAAVPLPAFLPRWGSGED LAALAHLVLPAGPERRRASLLAFAEDAPPSRARRRSAESLLSLRPSALDSGPRGARDSPP GSPRRRPGPGPRSASASLLPDAFALTAFECEPQALRRPPGPFPAAPAAPDGADPGEAPTP PSSAQRSPGPRPSAHSHAGSLRPGLSASWGEPGGLRAAGGGGSTSSFLSSPSESSGYATL HSDSLGSAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPR153 |
Synonyms | GPR153; PGR1; Probable G-protein coupled receptor 153; G-protein coupled receptor PGR1 |
UniProt ID | Q6NV75 |
◆ Recombinant Proteins | ||
KIAA0368-7533Z | Recombinant Zebrafish KIAA0368 | +Inquiry |
Carbonyl reductase-1546L | Recombinant Lactobacillus buchneri subsp. silagei CD034 Carbonyl reductase Protein (M1-W251) | +Inquiry |
ALB-1514M | Recombinant Mouse ALB Protein | +Inquiry |
EDNRB-3061H | Recombinant Human EDNRB Protein, GST-tagged | +Inquiry |
NOTCH1-0570M | Active Recombinant Mouse NOTCH1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
IgM-210R | Native Rabbit IgM | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELP-972MCL | Recombinant Mouse SELP cell lysate | +Inquiry |
FIGF-1265RCL | Recombinant Rat FIGF cell lysate | +Inquiry |
HNRNPD-5448HCL | Recombinant Human HNRNPD 293 Cell Lysate | +Inquiry |
AURKAIP1-8561HCL | Recombinant Human AURKAIP1 293 Cell Lysate | +Inquiry |
SUV420H1-1332HCL | Recombinant Human SUV420H1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GPR153 Products
Required fields are marked with *
My Review for All GPR153 Products
Required fields are marked with *
0
Inquiry Basket