Recombinant Full Length Mouse Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged
Cat.No. : | RFL23781MF |
Product Overview : | Recombinant Full Length Mouse Neuropeptide Y receptor type 2(Npy2r) Protein (P97295) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MVLKMGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQVILILA YCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEW KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGIS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIIS FSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH VLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMT FKAKKNLEVKKNNGPTDSFSEATNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Npy2r |
Synonyms | Npy2r; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor |
UniProt ID | P97295 |
◆ Recombinant Proteins | ||
OTUD6A-6438M | Recombinant Mouse OTUD6A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL665RF | Recombinant Full Length Rhodopseudomonas Palustris Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
ANKRD65-4624H | Recombinant Human ANKRD65 Protein, GST-tagged | +Inquiry |
Vsx2-890M | Recombinant Mouse Vsx2 Protein, MYC/DDK-tagged | +Inquiry |
RUVBL2-1181HFL | Recombinant Full Length Human RUVBL2 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
ALPL-25H | Active Native Human ALPL Protein | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAPDHS-6023HCL | Recombinant Human GAPDHS 293 Cell Lysate | +Inquiry |
ZCCHC3-1964HCL | Recombinant Human ZCCHC3 cell lysate | +Inquiry |
CSH2-7246HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
NAT8L-3960HCL | Recombinant Human NAT8L 293 Cell Lysate | +Inquiry |
DMWD-490HCL | Recombinant Human DMWD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Npy2r Products
Required fields are marked with *
My Review for All Npy2r Products
Required fields are marked with *
0
Inquiry Basket