Recombinant Full Length Chicken Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged
Cat.No. : | RFL178GF |
Product Overview : | Recombinant Full Length Chicken Neuropeptide Y receptor type 2(NPY2R) Protein (Q9DDN6) (1-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-385) |
Form : | Lyophilized powder |
AA Sequence : | MGPLEAIGEENQTDEMKMELFTKLYLPRYTTPVSELALDPKPELKDSTTLVEVQIILIFA YCSIILLGVIGNSLVIHVIIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLVYTLLGEW KLGPVLCHLVPYAQALAVHVSTVTLTVIALDRHRCIVYHLESKISKRISFLIIGVAWAVS ALLASPLAIFREYSLIEIIPDFKIVVCSEKWPGEGQLNYGTIYSVSMLLIQYVLPLAIIS YAYTRIWTKLKNHVSPGAGNDHYHHRRQKTTKMLVCVVVVFAVSWLPFHAFQLVSDIDSQ VLDLKEYKLIYTVFHVIAMCSTFANPLLYGWMNNNYRTAFLTAFQCEQRLDSIHPEVSAA FKARKKLEAKKSQFPGDSFTQPTNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NPY2R |
Synonyms | NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor |
UniProt ID | Q9DDN6 |
◆ Recombinant Proteins | ||
CNTN1B-2284Z | Recombinant Zebrafish CNTN1B | +Inquiry |
INHBA-1887H | Active Recombinant Human INHBA protein | +Inquiry |
Cxcl13-7160M | Recombinant Mouse Cxcl13 protein, His & GST-tagged | +Inquiry |
RPUSD4-3137H | Recombinant Human RPUSD4 protein, His-tagged | +Inquiry |
PSMB9-4436R | Recombinant Rat PSMB9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
VTN-386R | Native Rabbit Vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMI1-8437HCL | Recombinant Human BMI1 293 Cell Lysate | +Inquiry |
DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
DDOST-7024HCL | Recombinant Human DDOST 293 Cell Lysate | +Inquiry |
MYLPF-4013HCL | Recombinant Human MYLPF 293 Cell Lysate | +Inquiry |
GOLGA2-726HCL | Recombinant Human GOLGA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NPY2R Products
Required fields are marked with *
My Review for All NPY2R Products
Required fields are marked with *
0
Inquiry Basket