Recombinant Full Length Human Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged
Cat.No. : | RFL32673HF |
Product Overview : | Recombinant Full Length Human Neuropeptide Y receptor type 2(NPY2R) Protein (P49146) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK KNLEVRKNSGPNDSFTEATNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NPY2R |
Synonyms | NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor |
UniProt ID | P49146 |
◆ Recombinant Proteins | ||
RFL35064HF | Recombinant Full Length Human Protein G6B(G6B) Protein, His-Tagged | +Inquiry |
IL21-022M | Active Recombinant Mouse IL21, MIgG2a Fc-tagged, mutant | +Inquiry |
FGF10-3284H | Recombinant Human FGF10 Protein (Gln38-Ser208), C-His tagged | +Inquiry |
HINT2-1903R | Recombinant Rhesus Macaque HINT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LGALS8-2502R | Recombinant Rhesus monkey LGALS8 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
IgA-243C | Native Cat Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNE-5278HCL | Recombinant Human IFNE 293 Cell Lysate | +Inquiry |
MUC20-1154HCL | Recombinant Human MUC20 cell lysate | +Inquiry |
DDAH1-448HCL | Recombinant Human DDAH1 cell lysate | +Inquiry |
PCTP-3368HCL | Recombinant Human PCTP 293 Cell Lysate | +Inquiry |
AQP4-32HCL | Recombinant Human AQP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPY2R Products
Required fields are marked with *
My Review for All NPY2R Products
Required fields are marked with *
0
Inquiry Basket