Recombinant Full Length Bovine Neuropeptide Y Receptor Type 2(Npy2R) Protein, His-Tagged
Cat.No. : | RFL20568BF |
Product Overview : | Recombinant Full Length Bovine Neuropeptide Y receptor type 2(NPY2R) Protein (P79113) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MKMGPLGAEADENQTVEEMKVDQFGPGHTTLPGELAPDSEPELIDSTKLIEVQVVLILAY CSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWK MGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSA LLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTIYSLSSLLILYVLPLGIISF SYTRIWSKLKNHVSPGAAHDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHV LDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTF KAKKHLQVTKNNGPNDSFTETTNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NPY2R |
Synonyms | NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor |
UniProt ID | P79113 |
◆ Recombinant Proteins | ||
C1QTNF3-2761M | Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-tagged | +Inquiry |
CD274-178HAF647 | Active Recombinant Human CD274 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
FGF9-95M | Active Recombinant Mouse FGF9 Protein | +Inquiry |
KCNJ11-498H | Recombinant Human KCNJ11 | +Inquiry |
ACE2-817HB | Active Recombinant Human ACE2 protein, mFc-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HB-01H | Native Human HB Protein | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
Tnnt2-7425M | Native Mouse Tnnt2 Protein | +Inquiry |
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYBPHL-4040HCL | Recombinant Human MYBPHL 293 Cell Lysate | +Inquiry |
IGKV1-5-845HCL | Recombinant Human IGKV1-5 cell lysate | +Inquiry |
GNA15-5871HCL | Recombinant Human GNA15 293 Cell Lysate | +Inquiry |
TMLHE-918HCL | Recombinant Human TMLHE 293 Cell Lysate | +Inquiry |
BRD2-177HCL | Recombinant Human BRD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPY2R Products
Required fields are marked with *
My Review for All NPY2R Products
Required fields are marked with *
0
Inquiry Basket