Recombinant Full Length Mouse Mucolipin-2(Mcoln2) Protein, His-Tagged
Cat.No. : | RFL12255MF |
Product Overview : | Recombinant Full Length Mouse Mucolipin-2(Mcoln2) Protein (Q8K595) (1-566aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-566) |
Form : | Lyophilized powder |
AA Sequence : | MPGDEETLDLPAWNRVPDLTWGPHHRSAMASLDSEVREECLREDLKFYFMSPCEKYRARR QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGFSGVDEDDYSCS IYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETL NIDSDIETDCIHLDLQVLTTEPEDWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREI PDCYLFQNTITFDNTAHSGKIKIYLNSEANIEECKNMNISGSTQRSTHYLLVFDVFVIMI CLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNGWYVLVTISDLMTIIG SILKMEIKAKKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRF CACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFATFAQIQQKSILVW LFSRLYLYSFISLFIYMVLSLFIALITDSYHTIKKYQQHGFPETDLQKFLKESGSKDGYQ KQPSALLSCLCCLRRRRSNDHLILID |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mcoln2 |
Synonyms | Mcoln2; Mucolipin-2; Transient receptor potential channel mucolipin 2; TRPML2 |
UniProt ID | Q8K595 |
◆ Native Proteins | ||
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
FGA-79H | Active Native Human Fibrinogen | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF18-1660HCL | Recombinant Human FGF18 cell lysate | +Inquiry |
IGFBP3-2927HCL | Recombinant Human IGFBP3 cell lysate | +Inquiry |
RG9MTD3-2391HCL | Recombinant Human RG9MTD3 293 Cell Lysate | +Inquiry |
ZNF738-2082HCL | Recombinant Human ZNF738 cell lysate | +Inquiry |
GEN1-5957HCL | Recombinant Human GEN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mcoln2 Products
Required fields are marked with *
My Review for All Mcoln2 Products
Required fields are marked with *
0
Inquiry Basket