Recombinant Full Length Human Mucolipin-2(Mcoln2) Protein, His-Tagged
Cat.No. : | RFL25089HF |
Product Overview : | Recombinant Full Length Human Mucolipin-2(MCOLN2) Protein (Q8IZK6) (1-566aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-566) |
Form : | Lyophilized powder |
AA Sequence : | MARQPYRFPQARIPERGSGVFRLTVRNAMAHRDSEMKEECLREDLKFYFMSPCEKYRARR QIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDEDDYSCS VYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETL NIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSREL PDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQKNAQYVLVFDAFVIVI CLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFINGWYVLVIISDLMTIIG SILKMEIKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRF CACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVW LFSRLYLYSFISLFIYMILSLFIALITDSYDTIKKFQQNGFPETDLQEFLKECSSKEEYQ KESSAFLSCICCRRRKRSDDHLIPIS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MCOLN2 |
Synonyms | MCOLN2; Mucolipin-2; Transient receptor potential channel mucolipin 2; TRPML2 |
UniProt ID | Q8IZK6 |
◆ Native Proteins | ||
TTR-131H | Native Human Prealbumin protein | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRL-3693HCL | Recombinant Human NRL 293 Cell Lysate | +Inquiry |
CCNB1IP1-7717HCL | Recombinant Human CCNB1IP1 293 Cell Lysate | +Inquiry |
DNAJC15-6878HCL | Recombinant Human DNAJC15 293 Cell Lysate | +Inquiry |
KLKB1-4899HCL | Recombinant Human KLKB1 293 Cell Lysate | +Inquiry |
RNF13-2301HCL | Recombinant Human RNF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCOLN2 Products
Required fields are marked with *
My Review for All MCOLN2 Products
Required fields are marked with *
0
Inquiry Basket