Recombinant Full Length Mouse Lysophosphatidic Acid Receptor 4(Lpar4) Protein, His-Tagged
Cat.No. : | RFL17293MF |
Product Overview : | Recombinant Full Length Mouse Lysophosphatidic acid receptor 4(Lpar4) Protein (Q8BLG2) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN GGELMLESTF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lpar4 |
Synonyms | Lpar4; Gpr23; Lpa4; P2y9; Lysophosphatidic acid receptor 4; LPA receptor 4; LPA-4; G-protein coupled receptor 23; P2Y purinoceptor 9; P2Y9; Purinergic receptor 9 |
UniProt ID | Q8BLG2 |
◆ Recombinant Proteins | ||
Kitl-61M | Recombinant Mouse Kit Ligand | +Inquiry |
ISG15-61H | Recombinant Human ISG15 protein, His-tagged | +Inquiry |
Gap43-6817M | Recombinant Mouse Gap43 protein, His & T7-tagged | +Inquiry |
FAM150B-2222R | Recombinant Rat FAM150B Protein | +Inquiry |
ETF1-12564H | Recombinant Human ETF1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
FGA-78H | Active Native Human Fibrinogen (Pg & vWF depleted) | +Inquiry |
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
H1FX-2119HCL | Recombinant Human H1FX cell lysate | +Inquiry |
Small Intestine-458H | Human Small Intestine Membrane Tumor Lysate | +Inquiry |
STAU1-1414HCL | Recombinant Human STAU1 293 Cell Lysate | +Inquiry |
SESN2-1930HCL | Recombinant Human SESN2 293 Cell Lysate | +Inquiry |
FOPNL-8248HCL | Recombinant Human C16orf63 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lpar4 Products
Required fields are marked with *
My Review for All Lpar4 Products
Required fields are marked with *
0
Inquiry Basket