Recombinant Full Length Human LPAR4 Protein

• Cat.No.: LPAR4-5971HF
• Product Overview: Human LPAR4 full-length ORF (NP_005287.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• ProteinLength: 424 amino acids
• Description: This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in monocytic differentiation. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 41.9 kDa
• AA Sequence: MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: LPAR4 lysophosphatidic acid receptor 4 [ Homo sapiens ]
• Official Symbol: LPAR4
• Synonyms: LPAR4; lysophosphatidic acid receptor 4; G protein coupled receptor 23 , GPR23; LPA4; P2RY9; P2Y5 LIKE; P2Y9; LPA-4; LPA receptor 4; P2Y purinoceptor 9; P2Y5-like receptor; purinergic receptor 9; G protein-coupled receptor 23; G-protein coupled receptor 23; GPR23; P2Y5-LIKE
• Gene ID: 2846
• mRNA Refseq: NM_005296
• Protein Refseq: NP_005287
• MIM: 300086
• UniProt ID: Q99677