Recombinant Full Length Human Lysophosphatidic Acid Receptor 4(Lpar4) Protein, His-Tagged
Cat.No. : | RFL26756HF |
Product Overview : | Recombinant Full Length Human Lysophosphatidic acid receptor 4(LPAR4) Protein (Q99677) (1-370aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-370) |
Form : | Lyophilized powder |
AA Sequence : | MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN GGELMLESTF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LPAR4 |
Synonyms | LPAR4; GPR23; LPA4; P2RY9; Lysophosphatidic acid receptor 4; LPA receptor 4; LPA-4; G-protein coupled receptor 23; P2Y purinoceptor 9; P2Y9; P2Y5-like receptor; Purinergic receptor 9 |
UniProt ID | Q99677 |
◆ Native Proteins | ||
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLN-1680HCL | Recombinant Human SLN 293 Cell Lysate | +Inquiry |
PUM1-1445HCL | Recombinant Human PUM1 cell lysate | +Inquiry |
RWDD2A-2103HCL | Recombinant Human RWDD2A 293 Cell Lysate | +Inquiry |
C9orf169-7938HCL | Recombinant Human C9orf169 293 Cell Lysate | +Inquiry |
LSM3-9174HCL | Recombinant Human LSM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LPAR4 Products
Required fields are marked with *
My Review for All LPAR4 Products
Required fields are marked with *
0
Inquiry Basket