Recombinant Full Length Mouse Gastric Inhibitory Polypeptide Receptor(Gipr) Protein, His-Tagged
Cat.No. : | RFL11621MF |
Product Overview : | Recombinant Full Length Mouse Gastric inhibitory polypeptide receptor(Gipr) Protein (Q0P543) (19-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-460) |
Form : | Lyophilized powder |
AA Sequence : | ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARV SCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQIMYT VGYSLSLTTLLLALLILSLFRRLHCTRNYIHMNLFTSFMLRAAAILTRDQLLPPLGPYTG DQAPTPWNQALAACRTAQIMTQYCVGANYTWLLVEGVYLHHLLVIVGRSEKGHFRCYLLL GWGAPALFVIPWVIVRYLRENTQCWERNEVKAIWWIIRTPILITILINFLIFIRILGILV SKLRTRQMRCPDYRLRLARSTLTLVPLLGVHEVVFAPVTEEQVEGSLRFAKLAFEIFLSS FQGFLVSVLYCFINKEVQSEIRQGWRHRRLRLSLQEQRPRPHQELAPRAVPLSSACREAA VGNALPSGMLHVPGDEVLESYC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gipr |
Synonyms | Gipr; Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor |
UniProt ID | Q0P543 |
◆ Recombinant Proteins | ||
Gipr-1167M | Recombinant Mouse Gipr protein, His&Myc-tagged | +Inquiry |
Gipr-4603M | Recombinant Mouse Gipr protein, His-tagged | +Inquiry |
GIPR-2543R | Recombinant Rat GIPR Protein | +Inquiry |
GIPR-3733C | Recombinant Chicken GIPR | +Inquiry |
GIPR-5016H | Recombinant Human GIPR protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gipr Products
Required fields are marked with *
My Review for All Gipr Products
Required fields are marked with *
0
Inquiry Basket