Recombinant Mouse Gipr protein, His-tagged

• Cat.No.: Gipr-4603M
• Product Overview: Recombinant Mouse Gipr protein(Q0P543)(19-134aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Mouse
• Tag: C-His
• Protein length: 19-134aa
• Form: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody, the EC50 is 8.622-11.36 ng/ml.
• Molecular Mass: 14.7 kDa
• AASequence: ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Gipr gastric inhibitory polypeptide receptor [ Mus musculus ]
• Official Symbol: Gipr
• Synonyms: GIPR; gastric inhibitory polypeptide receptor; glucose-dependent insulinotropic polypeptide receptor; GIP-R; Gm160; Gm1081
• Gene ID: 381853
• mRNA Refseq: NM_001080815
• Protein Refseq: NP_001074284