Recombinant Full Length Human CX3CR1 Protein
Cat.No. : | CX3CR1-103HF |
Product Overview : | Recombinant full length Human CX3CR1 protein with a proprietary tag; predicted mwt: 65.12 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 355 amino acids |
Description : | Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 65.120kDa |
AA Sequence : | MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | Constituents: 0.79% Tris HCl, 0.31% Glutathione. Note: Reduced Glutathione. |
Gene Name | CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ] |
Official Symbol | CX3CR1 |
Synonyms | CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28 |
Gene ID | 1524 |
mRNA Refseq | NM_001171171 |
Protein Refseq | NP_001164642 |
MIM | 601470 |
UniProt ID | P49238 |
◆ Recombinant Proteins | ||
CX3CR1-1103R | Recombinant Rhesus monkey CX3CR1 Protein, His-tagged | +Inquiry |
CX3CR1-2947H | Active Recombinant Human CX3CR1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CX3CR1-1684R | Recombinant Rat CX3CR1 Protein | +Inquiry |
CX3CR1-2222HF | Recombinant Full Length Human CX3CR1 Protein, GST-tagged | +Inquiry |
RFL16386RF | Recombinant Full Length Rat Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CX3CR1-7173HCL | Recombinant Human CX3CR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CX3CR1 Products
Required fields are marked with *
My Review for All CX3CR1 Products
Required fields are marked with *
0
Inquiry Basket