Recombinant Full Length Human CX3CR1 Protein

• Cat.No.: CX3CR1-103HF
• Product Overview: Recombinant full length Human CX3CR1 protein with a proprietary tag; predicted mwt: 65.12 kDa.

Specification

• Description: Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 65.120kDa
• Protein length: 355 amino acids
• AA Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: Constituents: 0.79% Tris HCl, 0.31% Glutathione. Note: Reduced Glutathione.

Gene Information

• Gene Name: CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ]
• Official Symbol: CX3CR1
• Synonyms: CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28
• Gene ID: 1524
• mRNA Refseq: NM_001171171
• Protein Refseq: NP_001164642
• MIM: 601470
• UniProt ID: P49238