Recombinant Full Length Mouse Alkaline Ceramidase 1(Acer1) Protein, His-Tagged
Cat.No. : | RFL-17343MF |
Product Overview : | Recombinant Full Length Mouse Alkaline ceramidase 1(Acer1) Protein (Q8R4X1) (1-273aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-273) |
Form : | Lyophilized powder |
AA Sequence : | MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY AQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPK FVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRH LIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVLISITFPYGIVTMALVDAKY EMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Acer1 |
Synonyms | Acer1; Asah3; Alkaline ceramidase 1; AlkCDase 1; Alkaline CDase 1; maCER1; Acylsphingosine deacylase 3; N-acylsphingosine amidohydrolase 3 |
UniProt ID | Q8R4X1 |
◆ Recombinant Proteins | ||
Acer1-1494M | Recombinant Mouse Acer1 Protein, Myc/DDK-tagged | +Inquiry |
RFL-17343MF | Recombinant Full Length Mouse Alkaline Ceramidase 1(Acer1) Protein, His-Tagged | +Inquiry |
RFL-1430DF | Recombinant Full Length Danio Rerio Alkaline Ceramidase 1(Acer1) Protein, His-Tagged | +Inquiry |
ACER1-9287H | Recombinant Human ACER1, GST-tagged | +Inquiry |
ACER1-1828HFL | Recombinant Full Length Human ACER1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACER1-9093HCL | Recombinant Human ACER1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Acer1 Products
Required fields are marked with *
My Review for All Acer1 Products
Required fields are marked with *
0
Inquiry Basket