Recombinant Full Length Azoarcus Sp. Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL35798AF |
Product Overview : | Recombinant Full Length Azoarcus sp. Macrolide export ATP-binding/permease protein MacB(macB) Protein (A1K323) (1-656aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Azoarcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-656) |
Form : | Lyophilized powder |
AA Sequence : | MKREAFSPSASSTGAGTPLIELAGITRSFRNGEIETRVLHGIDLTIYPGEFVAIVGASGS GKSTLMNILGCLDRPSSGTYRFMGEDVAGFDRDELARLRREAFGFVFQSYNLLGGASARE NVEVPAVYSGMPPAERHARAEQLLASLGLGERSHHRPSQLSGGQQQRVSIARALMNGGRI ILADEPTGALDSRSGEEVMKLLRQLSAEGHTIILITHAREVAEMAQRIIEIRDGHIVADP GPSKPQGPEPDFAPHVDRTSSMSDLVEATRTALRALRANLFRSALTLLGIVIGVASVIAM LAIGDGAKAKVVDQISAMGTNLLTVRPGAPNQRGRETTATLVIEDVRAIAELPNVLASVP EQSASVTLRADNTDQRTTANATSWNYGVARNWPVASGTFFSAEDEARYATVAVLGQTTAG ALFPGVDPIGQYVLVNNIPFQVIGVMSPKGATPWGQDQDDIVFVPFTTGSLRVTGQRYLR NVTVAVEDVSRIDATQNEVSQLLLARHGVEDFQIRNMASVIDTVSATQNTLTILLGTVAA ISLLVGGIGVMNIMLVSVTERTREIGIRMATGARMKNILQQFLIEALVVSALGGLIGVAV GLGTAAVIALFDTPIKYSLLPVVLAFGCAFATGLVFGYLPARKAARLDPVVALASE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; azo0611; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | A1K323 |
◆ Recombinant Proteins | ||
AGMAT-291H | Recombinant Human AGMAT Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOA-34H | Active Recombinant Human RHOA protein, GST-tagged | +Inquiry |
E1A91-754C | Recombinant Cotton E1A91 protein, His-SUMO&His-tagged | +Inquiry |
CD38-3267H | Recombinant Human CD38 protein, His-tagged | +Inquiry |
RFL952MF | Recombinant Full Length Mouse Putative Small Membrane Protein Nid67(Nid67) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
C3c-11H | Native Human C3c Protein | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
LDH4-224H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOS1-1568HCL | Recombinant Human SOS1 293 Cell Lysate | +Inquiry |
PEX26-3287HCL | Recombinant Human PEX26 293 Cell Lysate | +Inquiry |
Skin-439H | Human Skin Cytoplasmic Lysate | +Inquiry |
SPERT-628HCL | Recombinant Human SPERT lysate | +Inquiry |
RASSF9-2493HCL | Recombinant Human RASSF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket