Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL6442VF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q87JM4) (1-654aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Parahaemolyticus Serotype O3:K6 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-654) |
Form : | Lyophilized powder |
AA Sequence : | MSDVLLKVEDLTRRFVSGDESLTVLNHINLEIKRGEMVAIVGASGSGKSTLMNVLGCLDK PSSGRYFINGQDVSTLESDQLAELRREYFGFIFQRYHLLGDLTAVANVEVPAVYAGVPHR QRTERAQSLLARLGLEDRLTHKPSQLSGGQQQRVSVARALMNGGEVILADEPTGALDSHS GQEMMALLKELHQLGHTIILVTHDMNVANFADRIIEIKDGEIIADTLNAQVVINEQAAKT PSASFHRPAQAVSKWWKWDSFIDALKMALLAMSSHRMRTFLTMLGIIIGIASVVSVVALG NGSQQQILSNISSMGTNTIDVRPGKGFGDRRSGRVKTLTADDAKSLESLPFVDSVTPSLS NSLTVRYANQDATASVEGVGEDYFRVRGYEIAKGQFWDEESVNSLAQEAVIDDNTRKEMF ADRNPIGEVIFLGSLPVRIVGVTQKKEDAFGNSDALKIWVPYTTMSGRMMGQRYLNGITV RIDENAPSAAVEQSIINLLKMRHGTEDFFTINTDTIRQSIEKTTATMTLLISAIAVISLI VGGIGVMNIMLVSVTERTKEIGVRMAVGARQADILRQFLIEAVLVCLCGGIAGIGLAFLI GFAFSTSGSSFQMIYSMNSIIWAFICSTLIGIAFGFLPARNAAKLDPIEALARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; VPA0224; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q87JM4 |
◆ Recombinant Proteins | ||
CYB5R3-5509C | Recombinant Chicken CYB5R3 | +Inquiry |
BTLA-082H | Recombinant Human BTLA Protein (Lys31-Ser150), C-mFc and 6×His-tagged | +Inquiry |
CD40LG-6887H | Recombinant Human CD40LG protein, monomeric hFc-tagged | +Inquiry |
PRDX6-328B | Recombinant Bovine PRDX6 Protein, His-tagged | +Inquiry |
PARP6A-660Z | Recombinant Zebrafish PARP6A | +Inquiry |
◆ Native Proteins | ||
Lectin-1719P | Native Peanut Lectin, FITC conjugated | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
SAP-96H | Native Human Serum amyloid P | +Inquiry |
Mannose Binding Lectin-044H | Native Human Mannose Binding Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERTM1-8297HCL | Recombinant Human C13orf36 293 Cell Lysate | +Inquiry |
MRPL53-4156HCL | Recombinant Human MRPL53 293 Cell Lysate | +Inquiry |
CDH20-7637HCL | Recombinant Human CDH20 293 Cell Lysate | +Inquiry |
PDGFRA-824RCL | Recombinant Rat PDGFRA cell lysate | +Inquiry |
ZDHHC2-193HCL | Recombinant Human ZDHHC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket