Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL20849SF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q83LR7) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTPLLELKDIRRSYPAGDEQVEVLKGISLNIYAGEMVAIVGASGSGKSTLMNILGCLDKA TSGTYRVAGQDIATLDADALAQLRREHFGFIFQRYHLLPHLTVEQNVEVPAVYAGLERKQ RLLRAQELLQRLGLEDRTEYYPAQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILHQLRDRGHTVIIVTHDPQVAAQAERVIEIRDGEIVRNPPAIEKVNVAGGTEPV VNTVSGWRQFVSGFNEALTMAWRALAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRY NNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVV GEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGF DSAEAEQQLTRLLSLRHGKKDFFTWNMDGVLKTVEKTTRTLQLFLTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAFTLQL FLPGWEIGFSPLALLLAFLCSTATGILFGWLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; SF0839; S0879; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q83LR7 |
◆ Recombinant Proteins | ||
TLE4-5810C | Recombinant Chicken TLE4 | +Inquiry |
CD48-1256R | Recombinant Rat CD48 Protein | +Inquiry |
Adora1-3159C | Recombinant Cavia porcellus (Guinea pig) Adora1, His-tagged | +Inquiry |
RFL19682MF | Recombinant Full Length Macaca Mulatta Mas-Related G-Protein Coupled Receptor Member X3(Mrgprx3) Protein, His-Tagged | +Inquiry |
SPRY4-2939H | Recombinant Human SPRY4, His-tagged | +Inquiry |
◆ Native Proteins | ||
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
FABP-174M | Native Cynomolgus Monkey Fatty acid Binding Protein | +Inquiry |
F2-1882H | Native Human Coagulation Factor II | +Inquiry |
Thromboplastin-078R | Native Rabbit Thromboplastin Protein | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHLDA3-3219HCL | Recombinant Human PHLDA3 293 Cell Lysate | +Inquiry |
TGM1-1111HCL | Recombinant Human TGM1 293 Cell Lysate | +Inquiry |
Pancreas-772C | Chicken Pancreas Membrane Lysate, Total Protein | +Inquiry |
HIST2H2AC-330HCL | Recombinant Human HIST2H2AC lysate | +Inquiry |
HIP1R-789HCL | Recombinant Human HIP1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket