Recombinant Full Length Rhodopseudomonas Palustris Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL14290RF |
Product Overview : | Recombinant Full Length Rhodopseudomonas palustris Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q217L2) (1-655aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodopseudomonas palustris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-655) |
Form : | Lyophilized powder |
AA Sequence : | MARSTIVLRGLRREYPSGEATVVALRDLDLTIEPGEMVAVMGASGSGKSTLMNILGCLDR PSSGSYQIAGRETASLDADELAALRREHFGFIFQRYHLLPELSALSNVEIPAIYAGQSRD ERRDRANGLLARLGITDRASHRPNQLSGGQQQRVSIARALMNGADVILADEPTGALDRRS GDEVLRILDELHADGKTVIIVTHDASVAARAKRVIELSDGVVIADRATSTVSPAVAAPTA AAAQAQPRSRWPWQSRLDRIGEAFRMAMLAMAAHRLRTFLTMLGIIIGIASVVFIVAVGD AAKRKVLADISSLGTNTIEIFPGKDLGDVRSSKIKTLVVADARALRLQPYIDGVTPTVST SSTLRHGPLEANALVNGVGDQYFAVKGTKLSAGRFFDADGLRDVSQDVVIDEKTRQTFFS DDPDGPIGKVLLVGRVPCRIIGVTQQQQGGFGSSQNLSVYLPYTTVQARFLGNSSLRSIL VKVNDEVTTKAAELDVTRFLTLRHRVKDFVILNTDDIRKTITNTTETLTLMIAAIAVISL VVGGIGVMNIMLVSVSERVGEIGVRMAVGARRSDILQQFLIEAVMVCLIGGGLGVAVAYG LAATFNALVPMFQLGLSAGSIIAAFICSTGIGVVFGYLPARQASFLDPLAALSRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; RPC_1867; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q217L2 |
◆ Native Proteins | ||
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
Collagen-325H | Native Human Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMUB1-1800HCL | Recombinant Human TMUB1 cell lysate | +Inquiry |
PALB2-3451HCL | Recombinant Human PALB2 293 Cell Lysate | +Inquiry |
SPOCK1-001HCL | Recombinant Human SPOCK1 cell lysate | +Inquiry |
MT1G-4101HCL | Recombinant Human MT1G 293 Cell Lysate | +Inquiry |
UBXN8-536HCL | Recombinant Human UBXN8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket