Recombinant Full Length Macaca Fascicularis Lanosterol 14-Alpha Demethylase(Cyp51A1) Protein, His-Tagged
Cat.No. : | RFL35269MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Lanosterol 14-alpha demethylase(CYP51A1) Protein (Q4R8S6) (1-503aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-503) |
Form : | Lyophilized powder |
AA Sequence : | MMLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLFRLAAGHLVQLPAGAKS PPYIFSPIPFLGHAIAFGKSPVEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAAALLFNS KNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETK EYFQSWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWL LPGWLPLPSFRRRDRAHREIKNIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDE VAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCYLEQKTVCGENLPPLTYDQLKDL NLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLD FNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFP TVNYTTMIHTPENPVIRYKRRSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP51A1 |
Synonyms | CYP51A1; CYP51; QtsA-11582; QtsA-20162; Lanosterol 14-alpha demethylase; LDM; CYPLI; Cytochrome P450 51A1; Cytochrome P450-14DM; Cytochrome P45014DM; Cytochrome P450LI; Sterol 14-alpha demethylase |
UniProt ID | Q4R8S6 |
◆ Recombinant Proteins | ||
NFYA-2838R | Recombinant Rhesus Macaque NFYA Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25968SF | Recombinant Full Length Salmonella Typhimurium Thiosulfate Reductase Cytochrome B Subunit(Phsc) Protein, His-Tagged | +Inquiry |
NOTCH1A-9009Z | Recombinant Zebrafish NOTCH1A | +Inquiry |
HA-1169I | Recombinant Influenza B (B/Harbin/7/1994) HA Protein, His-tagged | +Inquiry |
PMS1-3319H | Recombinant Human PMS1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-38R | Native Rhesus monkey Albumin (ALB) Protein | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUP93-3627HCL | Recombinant Human NUP93 293 Cell Lysate | +Inquiry |
MFGE8-422HCL | Recombinant Human MFGE8 cell lysate | +Inquiry |
Duodenum-114H | Human Duodenum Tumor Lysate | +Inquiry |
MIPEP-4310HCL | Recombinant Human MIPEP 293 Cell Lysate | +Inquiry |
SYNGR3-1317HCL | Recombinant Human SYNGR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CYP51A1 Products
Required fields are marked with *
My Review for All CYP51A1 Products
Required fields are marked with *
0
Inquiry Basket