Recombinant Full Length Lodderomyces Elongisporus Mitochondrial Inner Membrane I-Aaa Protease Complex Subunit Mgr1(Mgr1) Protein, His-Tagged
Cat.No. : | RFL20229LF |
Product Overview : | Recombinant Full Length Lodderomyces elongisporus Mitochondrial inner membrane i-AAA protease complex subunit MGR1(MGR1) Protein (A5DV96) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lodderomyces elongisporus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MGYIPPPGDNDDNGKKSNKKTQNTSKPISSDSTPDGTTITIINPMSLIPRNPSFGLIWGP LTPASDNRPAMYTMVALQIAIGVRFFRYARTHLRRHPVPQAQFHAPPGLGVNSMISTTAN QTYSAPPQQFLRRSKGDVFKSILAITTGSLLIFGSGLEIARMMLPYDPWYDEAQFYRKQA VRNGDKPNFWFGAYQYYQPMTYKEWHSKVSKWIDSVEKEIKVDETTFVIDKDGKARGGIG PAGVGYVNGAGQQSGAASAAAAVAKPLFQIRNRAKYQQIHAKLYNANETRMRELLANELN DTNVNELNKAERLDKILEGKSDLVNPNFNKPSISLGNHPMESDDEFEMVWLNFEPWDELK METDYDIRLIPRYASVEELEQVDEGELFVVKKEELGETDNVVNESS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MGR1 |
Synonyms | MGR1; LELG_01282; Mitochondrial inner membrane i-AAA protease complex subunit MGR1 |
UniProt ID | A5DV96 |
◆ Recombinant Proteins | ||
MYPN-2501H | Recombinant Human MYPN Protein, MYC/DDK-tagged | +Inquiry |
CFC1-785H | Active Recombinant Human CFC1 | +Inquiry |
B3GNT7-934M | Recombinant Mouse B3GNT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNF-528R | Recombinant Rhesus Macaque CCNF Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAR-529H | Recombinant Human ADAR protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C5-53H | Native Human Complement C5 | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDC1-1295RCL | Recombinant Rat SDC1 cell lysate | +Inquiry |
STOM-1393HCL | Recombinant Human STOM 293 Cell Lysate | +Inquiry |
ATP6V1F-8578HCL | Recombinant Human ATP6V1F 293 Cell Lysate | +Inquiry |
C7orf10-254HCL | Recombinant Human C7orf10 cell lysate | +Inquiry |
COQ5-7347HCL | Recombinant Human COQ5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGR1 Products
Required fields are marked with *
My Review for All MGR1 Products
Required fields are marked with *
0
Inquiry Basket