Recombinant Full Length Scheffersomyces Stipitis Mitochondrial Genome Required Protein 1(Mgr1) Protein, His-Tagged
Cat.No. : | RFL33699SF |
Product Overview : | Recombinant Full Length Scheffersomyces stipitis Mitochondrial genome required protein 1(MGR1) Protein (A3LN78) (1-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Scheffersomyces stipitis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-390) |
Form : | Lyophilized powder |
AA Sequence : | MGVYIPPPNDNDSDKDKKKNKNNDNPNLNPEPSGDSKKVNNVIKGVSSTSPPGTTTYYIP NPSTWIPHNPSAGLIWGPLTPSSDNRPALYGMVGLQFILGLGFFRAARQLYRPRTIVTSV NSIPQHFTPKGSFWKASIPALTGAVAIYGCGLELSRLMLAYDPWYEEAKYYRRVAIKNGD KPSAWFGAYDYYKPMSTKAWIDKVGIWIKATEHELSEKQEVLDVSIVQANSSNPDDKGHV EHVLIPVKKNNLMSQMNKKGKYVEIYNRLRESNKSRYRTLLDTDLKDVQELNKAERIDLI LEGKSPYSNPEYTKPHIQLGNHHVDTDDEFEMVWLNFEPWDELKLETDYDIRLIPHWRWA DSDNSEPELDAVEQQHNHSISEAESSKELV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MGR1 |
Synonyms | MGR1; PICST_40521; Mitochondrial genome required protein 1 |
UniProt ID | A3LN78 |
◆ Recombinant Proteins | ||
YCBM-1570B | Recombinant Bacillus subtilis YCBM protein, His-tagged | +Inquiry |
FAP-372H | Active Recombinant Human FAP Protein, hFc-tagged | +Inquiry |
ZNF624-3866H | Recombinant Human ZNF624, His-tagged | +Inquiry |
NPPB-2683H | Recombinant Human Natriuretic Peptides B, aa 1-108 | +Inquiry |
RFL4453ZF | Recombinant Full Length Zootermopsis Angusticollis Cytochrome C Oxidase Subunit 2(Coii) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
Lectin-1851U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 594 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTN2-2123HCL | Recombinant Human RTN2 293 Cell Lysate | +Inquiry |
Skin-442C | Cynomolgus monkey Skin Lysate | +Inquiry |
FTCD-6129HCL | Recombinant Human FTCD 293 Cell Lysate | +Inquiry |
COG3-379HCL | Recombinant Human COG3 cell lysate | +Inquiry |
IFIH1-5289HCL | Recombinant Human IFIH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGR1 Products
Required fields are marked with *
My Review for All MGR1 Products
Required fields are marked with *
0
Inquiry Basket