Recombinant Full Length Ashbya Gossypii Mitochondrial Inner Membrane I-Aaa Protease Complex Subunit Mgr1(Mgr1) Protein, His-Tagged
Cat.No. : | RFL24933AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Mitochondrial inner membrane i-AAA protease complex subunit MGR1(MGR1) Protein (Q751V6) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MALFTPPSEDKDGRDRSGGGDKASGVVRTPFHLRPSLGLALWGPLVPASDNRAGLWTLVG LQTLMGAFFVSRFRALRPKLLKRDIADFPSLNRFSKTSGDMHVGPVHVFADFGGTHSFHR RAGESPGFFQSRRFVSLKRALYLSTGVVLLVQSALESARLTLLVYDPWEEQARGVRDKQF YNDVVRYYHEGVDPARFIVKDPASGNTLPVNVPEVKQGVALARAHTNARNIITRWLGPLD CKPLSSSEFLDKLEHYLDTCDFIQDMNNKRLFGNPAEVKARQKALDALIQANKENRRRIR HILDITPPRGLPLSPKAVDQGLRSIILDPDHESTEDLDLHELWSIYNPWVDLALDTSLSI KFLPTVRTPEELLGDSEDTAVEQKNPPVQIKRERG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MGR1 |
Synonyms | MGR1; AFR719W; Mitochondrial inner membrane i-AAA protease complex subunit MGR1 |
UniProt ID | Q751V6 |
◆ Recombinant Proteins | ||
Enpp1-2434M | Recombinant Mouse Enpp1 protein, His-tagged | +Inquiry |
Spike-371V | Recombinant 2019-nCoV Spike S1(HV69-70 deletion, N439K, D614G) Protein, His-tagged | +Inquiry |
CHAD-3308HF | Recombinant Full Length Human CHAD Protein, GST-tagged | +Inquiry |
RPSD-3158S | Recombinant Staphylococcus epidermidis ATCC 12228 RPSD protein, His-tagged | +Inquiry |
ERBB2-01 | Recombinant HER2/neu (478-584) | +Inquiry |
◆ Native Proteins | ||
RPE-425 | Native Red algae RPE | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
Lectin-1744M | Active Native Maclura Pomifera Lectin Protein | +Inquiry |
IgG-219H | Native Human Immunoglobulin G | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTK-671HCL | Recombinant Human TTK 293 Cell Lysate | +Inquiry |
HSV1-648HCL | Native Herpes Simplex Virus 1 Lysate | +Inquiry |
CPA1-2171HCL | Recombinant Human CPA1 cell lysate | +Inquiry |
RNF122-2304HCL | Recombinant Human RNF122 293 Cell Lysate | +Inquiry |
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGR1 Products
Required fields are marked with *
My Review for All MGR1 Products
Required fields are marked with *
0
Inquiry Basket