Recombinant Full Length Listeria Innocua Serovar 6A Potassium-Transporting Atpase B Chain 1(Kdpb1) Protein, His-Tagged
Cat.No. : | RFL19404LF |
Product Overview : | Recombinant Full Length Listeria innocua serovar 6a Potassium-transporting ATPase B chain 1(kdpB1) Protein (Q927G0) (1-681aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria innocua serovar 6a |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-681) |
Form : | Lyophilized powder |
AA Sequence : | MMENGIWKDALIQSMKKLSPKLQVKNPVMLLVYVGAILATSLYFLGFFGISDEKAGYTLA IALILWFTVLFANFAEAIAEGRGRAQADSLKMARKDVLARKLKNLEDKSDVIEVASNDLK KGDIVYVLANEQIPMDGEVIEGAASVDESAITGESAPVIRESGGDRSAVTGGTTLVSDWL VIRVTAVSGESFLDKMIAMVEGASRKKTPNEIALQILLVTLSIIFLAVSATLLPFTEFAS KQAGAGSAISITNVIALLVCLAPTTIGALLSSIGIAGMSRLNQANVLAMSGRAIEAAGDV DVLLLDKTGTITLGNRKASEFLPVDGVTEQELADAAQLSSIADETAEGRSIVVLAKERFD IRGRDFAEMHAEFVPFTATTRMSGIDYQGNTIRKGAADAVRAYVSANGGTYPKECDTIVS KVAGAGGTPLVVVRNNKVLGVIYLKDIVKNGVKERFLDLRKMGIKTIMITGDNPMTAAAI AAEAGVDDFLAEATPEAKLELIREYQREGHLVAMTGDGTNDAPALAQADVAVAMNTGTQA AKEAGNMVDLDSSPTKLIDIVRIGKQLLMTRGALTTFSVANDLAKYFAIIPVLFYGIFPQ LEALNLMDLTSPTSAILSAIIYNAVIIIFLIPLSLKGVKYREMPAGKLLSRNMLIYGLGG LIAPFIAIKLIDMLLTVLGIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdpB1 |
Synonyms | kdpB1; lin2829; Potassium-transporting ATPase ATP-binding subunit 1; ATP phosphohydrolase [potassium-transporting] B chain 1; Potassium-binding and translocating subunit B 1; Potassium-translocating ATPase B chain 1 |
UniProt ID | Q927G0 |
◆ Recombinant Proteins | ||
GRPEL1-2376R | Recombinant Rat GRPEL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFB3-006N | Recombinant Human Transforming Growth Factor, Beta 3, Dimeric Form | +Inquiry |
S100B-4571H | Recombinant Human S100 Calcium Binding Protein B, GST-tagged | +Inquiry |
FOXG1-5072HF | Recombinant Full Length Human FOXG1 Protein, GST-tagged | +Inquiry |
IGSF8-500H | Recombinant Human IGSF8 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
Cry1Ab-36B | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PALM2-1277HCL | Recombinant Human PALM2 cell lysate | +Inquiry |
MOLT-4-021HCL | Human MOLT-4 Whole Cell Lysate | +Inquiry |
PICK1-3198HCL | Recombinant Human PICK1 293 Cell Lysate | +Inquiry |
NPR3-3732HCL | Recombinant Human NPR3 293 Cell Lysate | +Inquiry |
GDF9-5966HCL | Recombinant Human GDF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All kdpB1 Products
Required fields are marked with *
My Review for All kdpB1 Products
Required fields are marked with *
0
Inquiry Basket