Recombinant Full Length Klebsiella Pneumoniae Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL2894KF |
Product Overview : | Recombinant Full Length Klebsiella pneumoniae Bifunctional protein aas(aas) Protein (B5XUP2) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLLGFFRLLFKGLYRVRLTGDTQALYQQKVLITPNHVSFLDGILLALFLPVRPVFAVYTS ISQRWFMRALTPIIDFVPLDPTKPMSIKHLVRLIEQGRPVVIFPEGRISVSGSLMKIYDG AAFVAAKSQATIVPLRIDGAELTPFSRLKGLVKRRLFPRIQLHLLPPTHLPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQDRFGARKPCVEDINFQPDTYRKLLTK TLFVARILEKYSQRGEKIGLMLPNAGISAAVIFGAIARGRIPAMMNYTAGVKGLSSAIAA AEINTIFTSRTFLDKGKLWHLPEQLTQVRWVFLEDLKGDITLADKLWIFGHLLAPRLAQV KQQPEDAAMILFTSGSEGNPKGVVHSHKSLLANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLLTPLFTGAEVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLANYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKVGTVGRILPGM DARLLAMPGIEQGGRLQLKGPNIMKGYLRVENPGVLEAPAAENQHGEKEAGWYDTGDIVT FDEQGYVRIQGRAKRFAKIAGEMISLEMVEQVALGASPDKMHATAIKQDASKGEALVLFT TDNELTREALLRYARQHGVPELAVPRDIRWLKQLPVLGSGKPDYVTLKNMVDEAETTHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; KPK_0869; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long |
UniProt ID | B5XUP2 |
◆ Recombinant Proteins | ||
HA1-1923I | Recombinant IBV (B/Athens/97/2012) HA1 Protein, His-tagged | +Inquiry |
mip-4281L | Recombinant Legionella pneumophila mip protein, His-SUMO-tagged | +Inquiry |
UBE2H-2354C | Recombinant Chicken UBE2H | +Inquiry |
TDP2-6706H | Recombinant Human TDP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LOC84740-607H | Recombinant Human LOC84740, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SNCA-27341TH | Native Human SNCA | +Inquiry |
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
Lectin-1734U | Active Native Ulex Europaeus Agglutinin I Protein, Rhodamine labeled | +Inquiry |
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC24A6-1787HCL | Recombinant Human SLC24A6 293 Cell Lysate | +Inquiry |
SELK-582HCL | Recombinant Human SELK lysate | +Inquiry |
SCART1-1020HCL | Recombinant Human SCART1 cell lysate | +Inquiry |
APCDD1L-8799HCL | Recombinant Human APCDD1L 293 Cell Lysate | +Inquiry |
EHF-6687HCL | Recombinant Human EHF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket