Recombinant Full Length Escherichia Coli Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL2272EF |
Product Overview : | Recombinant Full Length Escherichia coli Bifunctional protein aas(aas) Protein (B1IU08) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVAMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; EcolC_0879; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Lo |
UniProt ID | B1IU08 |
◆ Recombinant Proteins | ||
MORN2-9966M | Recombinant Mouse MORN2 Protein | +Inquiry |
EPS8L1-1465H | Recombinant Human EPS8L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCO5366-575S | Recombinant Streptomyces coelicolor A3(2) SCO5366 protein, His-tagged | +Inquiry |
ELP6-2084R | Recombinant Rat ELP6 Protein | +Inquiry |
YLAE-4099B | Recombinant Bacillus subtilis YLAE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
H1N12099-209I | Native H1N1 (A/New Caledonia/20/99) H1N12099 protein | +Inquiry |
Lectin-1847S | Active Native Soybean Agglutinin Protein, Fluorescein labeled | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
Proteasome 19S-39H | Native Human Proteasome 19S Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
F7-1973HCL | Recombinant Human F7 cell lysate | +Inquiry |
MPPED1-4227HCL | Recombinant Human MPPED1 293 Cell Lysate | +Inquiry |
A549-043WCY | Human Lung Adenocarcinoma A549 Whole Cell Lysate | +Inquiry |
SAA4-2078HCL | Recombinant Human SAA4 293 Cell Lysate | +Inquiry |
CALML3-7887HCL | Recombinant Human CALML3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket