Recombinant Full Length Human TYRP1 Protein, C-Flag-tagged
Cat.No. : | TYRP1-883HFL |
Product Overview : | Recombinant Full Length Human TYRP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a melanosomal enzyme that belongs to the tyrosinase family and plays an important role in the melanin biosynthetic pathway. Defects in this gene are the cause of rufous oculocutaneous albinism and oculocutaneous albinism type III. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58 kDa |
AA Sequence : | MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTA DSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEE KNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGE VDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPN SVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSN STNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLV ALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Melanogenesis, Metabolic pathways, Tyrosine metabolism |
Full Length : | Full L. |
Gene Name | TYRP1 tyrosinase related protein 1 [ Homo sapiens (human) ] |
Official Symbol | TYRP1 |
Synonyms | TRP; CAS2; CATB; GP75; OCA3; TRP1; TYRP; b-PROTEIN |
Gene ID | 7306 |
mRNA Refseq | NM_000550.3 |
Protein Refseq | NP_000541.1 |
MIM | 115501 |
UniProt ID | P17643 |
◆ Recombinant Proteins | ||
TYRP1-17676M | Recombinant Mouse Tyrp1 Protein, His-tagged | +Inquiry |
TYRP1-3688H | Recombinant Human TYRP1 protein, His-tagged | +Inquiry |
TYRP1-883HFL | Recombinant Full Length Human TYRP1 Protein, C-Flag-tagged | +Inquiry |
RFL5115HF | Recombinant Full Length Human 5,6-Dihydroxyindole-2-Carboxylic Acid Oxidase(Tyrp1) Protein, His-Tagged | +Inquiry |
TYRP1-512H | Recombinant Human TYRP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYRP1-473HCL | Recombinant Human TYRP1 cell lysate | +Inquiry |
TYRP1-1641HCL | Recombinant Human TYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TYRP1 Products
Required fields are marked with *
My Review for All TYRP1 Products
Required fields are marked with *
0
Inquiry Basket