Active Recombinant Mouse Tnfsf12 Protein, His-Tagged

Cat.No. : Tnfsf12-01M
Product Overview : Recombinant mouse Tnfsf12 Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : TWEAK belongs to the TNF family of ligands, and also known as TNFRSF12A through TWEAK receptor signaling. TWEAK wildly expresses in a variety of tissues, including the adult heart, pancreas, skeletal muscle, small intestine, spleen and peripheral blood lymphocytes. TWEAK has the ability to trigger activation and chemokine secretion of NF-κB, and to apply an apoptotic activity in certain cells, such as HT-29 human cultured adenocarcinoma cells feeding with IFN-γ. TWEAK also promotes proliferation and migration of endothelial cells.
Form : Lyophilized powder
AA Sequence : MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLV
NGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <0.2 μg/mL.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Tnfsf12 tumor necrosis factor (ligand) superfamily, member 12 [ Mus musculus (house mouse) ]
Official Symbol Tnfsf12
Synonyms Dr3l; Apo3l; Dr3lg; Tweak
Gene ID 21944
mRNA Refseq NM_011614.3
Protein Refseq NP_035744.1
UniProt ID O54907

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Tnfsf12 Products

Required fields are marked with *

My Review for All Tnfsf12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon