Active Recombinant Mouse Tnfsf12 Protein, His-Tagged
Cat.No. : | Tnfsf12-01M |
Product Overview : | Recombinant mouse Tnfsf12 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | TWEAK belongs to the TNF family of ligands, and also known as TNFRSF12A through TWEAK receptor signaling. TWEAK wildly expresses in a variety of tissues, including the adult heart, pancreas, skeletal muscle, small intestine, spleen and peripheral blood lymphocytes. TWEAK has the ability to trigger activation and chemokine secretion of NF-κB, and to apply an apoptotic activity in certain cells, such as HT-29 human cultured adenocarcinoma cells feeding with IFN-γ. TWEAK also promotes proliferation and migration of endothelial cells. |
Form : | Lyophilized powder |
AA Sequence : | MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLV NGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <0.2 μg/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Tnfsf12 tumor necrosis factor (ligand) superfamily, member 12 [ Mus musculus (house mouse) ] |
Official Symbol | Tnfsf12 |
Synonyms | Dr3l; Apo3l; Dr3lg; Tweak |
Gene ID | 21944 |
mRNA Refseq | NM_011614.3 |
Protein Refseq | NP_035744.1 |
UniProt ID | O54907 |
◆ Recombinant Proteins | ||
ABHD3-9241H | Recombinant Human ABHD3 protein, His-tagged | +Inquiry |
TNFSF12-70H | Active Recombinant Human TWEAK, FLAG-tagged | +Inquiry |
TNFSF12-810M | Recombinant Mouse TNFSF12 protein(Arg105-His249), rFc-tagged | +Inquiry |
TNFSF12-8461H | Active Recombinant Human TNFSF12 | +Inquiry |
Tnfsf12-1069M | Recombinant Mouse Tnfsf12 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF12-1204RCL | Recombinant Rat TNFSF12 cell lysate | +Inquiry |
TNFSF12-1155CCL | Recombinant Cynomolgus TNFSF12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnfsf12 Products
Required fields are marked with *
My Review for All Tnfsf12 Products
Required fields are marked with *
0
Inquiry Basket