Active Recombinant Mouse Tnfsf12 Protein, His-Tagged

• Cat.No.: Tnfsf12-01M
• Product Overview: Recombinant mouse Tnfsf12 Protein, His-tagged was expressed in E. coli cell

Specification

• Description: TWEAK belongs to the TNF family of ligands, and also known as TNFRSF12A through TWEAK receptor signaling. TWEAK wildly expresses in a variety of tissues, including the adult heart, pancreas, skeletal muscle, small intestine, spleen and peripheral blood lymphocytes. TWEAK has the ability to trigger activation and chemokine secretion of NF-κB, and to apply an apoptotic activity in certain cells, such as HT-29 human cultured adenocarcinoma cells feeding with IFN-γ. TWEAK also promotes proliferation and migration of endothelial cells.
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized powder
• AA Sequence: MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLV
  NGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <0.2 μg/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Tnfsf12 tumor necrosis factor (ligand) superfamily, member 12 [ Mus musculus (house mouse) ]
• Official Symbol: Tnfsf12
• Synonyms: Dr3l; Apo3l; Dr3lg; Tweak
• Gene ID: 21944
• mRNA Refseq: NM_011614.3
• Protein Refseq: NP_035744.1
• UniProt ID: O54907