Recombinant Full Length Human TRIB2 Protein, C-Flag-tagged
Cat.No. : | TRIB2-1626HFL |
Product Overview : | Recombinant Full Length Human TRIB2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.6 kDa |
AA Sequence : | MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPL EGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSF VRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLS DKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPK AKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | TRIB2 tribbles pseudokinase 2 [ Homo sapiens (human) ] |
Official Symbol | TRIB2 |
Synonyms | C5FW; TRB2; GS3955 |
Gene ID | 28951 |
mRNA Refseq | NM_021643.4 |
Protein Refseq | NP_067675.1 |
MIM | 609462 |
UniProt ID | Q92519 |
◆ Recombinant Proteins | ||
TRIB2-3078H | Recombinant Human TRIB2, None tagged | +Inquiry |
TRIB2-3404H | Recombinant Human TRIB2, GST-tagged | +Inquiry |
TRIB2-3361H | Recombinant Human TRIB2 protein, His-tagged | +Inquiry |
TRIB2-5971C | Recombinant Chicken TRIB2 | +Inquiry |
TRIB2-1626HFL | Recombinant Full Length Human TRIB2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIB2-635HCL | Recombinant Human TRIB2 cell lysate | +Inquiry |
TRIB2-645HCL | Recombinant Human TRIB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIB2 Products
Required fields are marked with *
My Review for All TRIB2 Products
Required fields are marked with *
0
Inquiry Basket