Recombinant Human TRIB2 protein, His-tagged
Cat.No. : | TRIB2-3361H |
Product Overview : | Recombinant Human TRIB2 protein(1-343 aa), fused to His tag, was expressed in E. coli. |
Availability | April 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-343 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRIB2 tribbles homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | TRIB2 |
Synonyms | TRIB2; tribbles homolog 2 (Drosophila); tribbles homolog 2; GS3955; TRB2; C5FW; FLJ57420; |
Gene ID | 28951 |
mRNA Refseq | NM_021643 |
Protein Refseq | NP_067675 |
MIM | 609462 |
UniProt ID | Q92519 |
◆ Recombinant Proteins | ||
TRIB2-3852H | Recombinant Human Tribbles Homolog 2 (Drosophila), GST-tagged | +Inquiry |
TRIB2-326H | Recombinant Human TRIB2 Protein, His-tagged | +Inquiry |
TRIB2-2217H | Recombinant Human TRIB2 protein, His&GST-tagged | +Inquiry |
TRIB2-24H | Recombinant Human TRIB2, GST-tagged | +Inquiry |
TRIB2-2622H | Recombinant Human TRIB2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIB2-645HCL | Recombinant Human TRIB2 cell lysate | +Inquiry |
TRIB2-635HCL | Recombinant Human TRIB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIB2 Products
Required fields are marked with *
My Review for All TRIB2 Products
Required fields are marked with *
0
Inquiry Basket