Recombinant Full Length Human Transmembrane Protein 87B(Tmem87B) Protein, His-Tagged
Cat.No. : | RFL13239HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 87B(TMEM87B) Protein (Q96K49) (43-555aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (43-555) |
Form : | Lyophilized powder |
AA Sequence : | VPELGLWLETVNDKSGPLIFRKTMFNSTDIKLSVKSFHCSGPVKFTIVWHLKYHTCHNEH SNLEELFQKHKLSVDEDFCHYLKNDNCWTTKNENLDCNSDSQVFPSLNNKELINIRNVSN QERSMDVVARTQKDGFHIFIVSIKTENTDASWNLNVSLSMIGPHGYISASDWPLMIFYMV MCIVYILYGILWLTWSACYWKDILRIQFWIAAVIFLGMLEKAVFYSEYQNISNTGLSTQG LLIFAELISAIKRTLARLLVIIVSLGYGIVKPRLGTVMHRVIGLGLLYLIFAAVEGVMRV IGGSNHLAVVLDDIILAVIDSIFVWFIFISLAQTMKTLRLRKNTVKFSLYRHFKNTLIFA VLASIVFMGWTTKTFRIAKCQSDWMERWVDDAFWSFLFSLILIVIMFLWRPSANNQRYAF MPLIDDSDDEIEEFMVTSENLTEGIKLRASKSVSNGTAKPATSENFDEDLKWVEENIPSS FTDVALPVLVDSDEEIMTRSEMAEKMFSSEKIM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM87B |
Synonyms | TMEM87B; Transmembrane protein 87B |
UniProt ID | Q96K49 |
◆ Recombinant Proteins | ||
SPP1-6348H | Recombinant Human SPP1 Protein (Ile17-Asn314), C-His tagged | +Inquiry |
AYP1020-RS07470-4870S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS07470 protein, His-tagged | +Inquiry |
HES2-1092H | Recombinant Human HES2 Protein, MYC/DDK-tagged | +Inquiry |
PPID-3760H | Recombinant Human PPID protein, His-tagged | +Inquiry |
rbcL-755R | Recombinant Rice rbcL protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
C4-195H | Native Human Complement C4c | +Inquiry |
IgG-01C | Native Human COVID-19 Convalescent Plasma IgG | +Inquiry |
Collagen type I-01H | Native Human Collagen type I Protein | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMPDL3B-1654HCL | Recombinant Human SMPDL3B 293 Cell Lysate | +Inquiry |
MARK1-4465HCL | Recombinant Human MARK1 293 Cell Lysate | +Inquiry |
F11-2681HCL | Recombinant Human F11 cell lysate | +Inquiry |
Fetal Ovary-153H | Human Fetal Ovary Membrane Lysate | +Inquiry |
EFTUD2-6698HCL | Recombinant Human EFTUD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM87B Products
Required fields are marked with *
My Review for All TMEM87B Products
Required fields are marked with *
0
Inquiry Basket