Recombinant Full Length Mouse Transmembrane Protein 87B(Tmem87B) Protein, His-Tagged
Cat.No. : | RFL27084MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 87B(Tmem87b) Protein (Q8BKU8) (43-555aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (43-555) |
Form : | Lyophilized powder |
AA Sequence : | VPELGLWTRTVNDKSGPLVFRKTMFNSTEIKFSVKSFSCSGPVKFTIEWHLKYHTCHNDY PDLEEELSQRHELHADPDVCAYFKNIDCWTTKSENLDCSSDSQAFPSLNNKELTGIRNIS SQEGSTDVVARTQKDGFHIFIVSIKTEKTDAVWDLNVSLSMVGPHGYISASDWPLMIFYM VMCIVYILYGVLWLLWSACYWKDILRIQFWIAAVIFLGMLEKAVFYSEYQNINSTGLSTQ GLLIFAELISAVKRTLARLLVIIVSLGYGIVKPRLGTVMHRVIGLGLLYLIFAAIEGVMR VIGGSKHLAVVLTDIVLAVIDSIFVWFIFISLAQTMKTLRLRKNTVKFSLYRHFTNTLIF AVLASIVFMVWTTKTFRIAKCQSDWMELWVDDAFWSFLFSVILIVIMFLWRPSANNQRYA FMPLIDDSDDEVEEFMVTSENLTEGIKLRASKTVSNGTAKPTSDNFDEDLKWVEENIPSS FTDVALPVLVDSDEEIMTRSEIAEKMFSSEKIM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem87b |
Synonyms | Tmem87b; Transmembrane protein 87B |
UniProt ID | Q8BKU8 |
◆ Native Proteins | ||
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
Collagen-120B | Native Bovine Type I Collagen, FITC-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCI-H23-041WCY | Human Lung Adenocarcinoma NCI-H23 Whole Cell Lysate | +Inquiry |
SLC20A1-1797HCL | Recombinant Human SLC20A1 293 Cell Lysate | +Inquiry |
ACVR2A-2280MCL | Recombinant Mouse ACVR2A cell lysate | +Inquiry |
KCNIP3-5053HCL | Recombinant Human KCNIP3 293 Cell Lysate | +Inquiry |
Heart Atrium-202H | Human Heart Atrium (RT) (Arrhythmia, infarct) Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem87b Products
Required fields are marked with *
My Review for All Tmem87b Products
Required fields are marked with *
0
Inquiry Basket