Recombinant Full Length Southern Bean Mosaic Virus Replicase Polyprotein P2Ab (Orf2A-2B) Protein, His-Tagged
Cat.No. : | RFL28244SF |
Product Overview : | Recombinant Full Length Southern bean mosaic virus Replicase polyprotein P2AB (ORF2A-2B) Protein (O72157) (403-962aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Southern bean mosaic virus (isolate Bean/United States/Arkansas) (SBMV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (403-962) |
Form : | Lyophilized powder |
AA Sequence : | TVAEPLNLPAGGRVKALAALSQLAGYDFKEGEAASTRGMPLRFVGQSACKFRELCRKDTP DEVLRATRVFPELSDFSWPERGSKAELHSLLLQAGKFNPTGIPRNLEGACQNLLERYPAS KSCYCLRGEAWSFDAVYEEVCKKAQSAEINEKASPGVPLSRLASTNKDLLKRHLELVALC VTERLFLLSEAEDLLDESPVDLVRRGLCDPVRLFVKQEPHASRKVREGRFRLISSVSLVD QLVERMLFGPQNQLEIAEWEHIPSKPGMGLSLRQQAKSLFDDLRVKHSRCPAAEADISGF DWSVQDWELWADVEMRIVLGGFGHKLAKAAQNRFSCFMNSVFQLSDGTLIEQQLPGIMKS GSYCTSSTNSRIRCLMAELIGSPWCIAMGDDSVEGWVDGAKDKYMRLGHTCKDYKPCATT ISGRLYEVEFCSHVIREDRCWLASWPKTLFKYLSEGKWFFEDLERDVSSSPHWPRIRHYV VGNTPSPHKTNLQNQSPRYGEEVDKTTVNQGYSEHSGSPGHSIEEAQEPEAAPFCCEAAS VYPGWGVHGPYCSGDYGSLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF2A-2B |
Synonyms | ORF2A-2B; Replicase polyprotein P2AB |
UniProt ID | O72157 |
◆ Recombinant Proteins | ||
OXCT2-1485H | Recombinant Human OXCT2, GST-tagged | +Inquiry |
Esm1-7412M | Recombinant Mouse Esm1 Protein, His-tagged | +Inquiry |
PRKCG-7095M | Recombinant Mouse PRKCG Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL21489SF | Recombinant Full Length Staphylococcus Epidermidis Upf0382 Membrane Protein Serp0230(Serp0230) Protein, His-Tagged | +Inquiry |
TMEM151B-16933M | Recombinant Mouse TMEM151B Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
LOX3-185G | Native Glycine max LOX3 Protein | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
CKM-26522TH | Native Human CKM | +Inquiry |
◆ Cell & Tissue Lysates | ||
EAF2-523HCL | Recombinant Human EAF2 cell lysate | +Inquiry |
AOAH-8824HCL | Recombinant Human AOAH 293 Cell Lysate | +Inquiry |
PNMT-3075HCL | Recombinant Human PNMT 293 Cell Lysate | +Inquiry |
HA-2255HCL | Recombinant H8N4 HA cell lysate | +Inquiry |
FATE1-6321HCL | Recombinant Human FATE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF2A-2B Products
Required fields are marked with *
My Review for All ORF2A-2B Products
Required fields are marked with *
0
Inquiry Basket