Recombinant Full Length Escherichia Coli Upf0014 Inner Membrane Protein Ybbm(Ybbm) Protein, His-Tagged
Cat.No. : | RFL10570EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0014 inner membrane protein ybbM(ybbM) Protein (P77307) (1-259aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-259) |
Form : | Lyophilized powder |
AA Sequence : | MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAIIQLIIVGYVLKYIFSV DDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAGITLAVLILSGSIEFIP MQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLGATPKQASAILIRDSIRA ALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVTFMLLSTASLSTIIACYLT YRKFYNSRHQLVVTQLKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fetB |
Synonyms | fetB; ybbM; b0491; JW5066; Probable iron export permease protein FetB |
UniProt ID | P77307 |
◆ Recombinant Proteins | ||
MPDZ-3733R | Recombinant Rat MPDZ Protein | +Inquiry |
SRRT-8733M | Recombinant Mouse SRRT Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL26507CF | Recombinant Full Length Transmembrane Protein 151 Homolog(Zk1067.4) Protein, His-Tagged | +Inquiry |
ADAMTS7-3008M | Recombinant Mouse ADAMTS7, His-tagged | +Inquiry |
Sema4d-5760M | Recombinant Mouse Sema4d Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA3-8008H | Native Human Serum Alpha 1-AntiChymoTrypsin | +Inquiry |
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
Immunoglobulin G4-84H | Native Human Immunoglobulin G4 | +Inquiry |
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCRL-273HCL | Recombinant Human CALCRL cell lysate | +Inquiry |
PHACTR4-3243HCL | Recombinant Human PHACTR4 293 Cell Lysate | +Inquiry |
LURAP1L-139HCL | Recombinant Human LURAP1L lysate | +Inquiry |
LSM11-4611HCL | Recombinant Human LSM11 293 Cell Lysate | +Inquiry |
C20orf3-8116HCL | Recombinant Human C20orf3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fetB Products
Required fields are marked with *
My Review for All fetB Products
Required fields are marked with *
0
Inquiry Basket