Recombinant Full Length Human TOX Protein, C-Flag-tagged
Cat.No. : | TOX-1411HFL |
Product Overview : | Recombinant Full Length Human TOX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene contains a HMG box DNA binding domain. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. This protein may function to regulate T-cell development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.3 kDa |
AA Sequence : | MDVRFYPPVAQPAAAPDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNI PPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITVSNMLGQDGTLLSNSISVMPD IRNPEGTQYSSHPQMAAMRPRGQPADIRQQPGMMPHGQLTTINQSQLSAQLGLNMGGSNVPHNSPSPPGS KSATPSPSSSVHEDEGDDTSKINGGEKRPASDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIK GQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYSEPVDVKTSQPPQ LINSKPSVFHGPSQAHSALYLSSHYHQQPGMNPHLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP LQISPPLHQHLNMQQHQPLTMQQPLGNQLPMQVQSALHSPTMQQGFTLQPDYQTIINPTSTAAQVVTQAM EYVRSGCRNPPPQPVDWNNDYCSSGGMQRDKALYLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | TOX thymocyte selection associated high mobility group box [ Homo sapiens (human) ] |
Official Symbol | TOX |
Synonyms | TOX1 |
Gene ID | 9760 |
mRNA Refseq | NM_014729.3 |
Protein Refseq | NP_055544.1 |
MIM | 606863 |
UniProt ID | O94900 |
◆ Recombinant Proteins | ||
LOC5578521-0678A | Recombinant Aedes aegypti LOC5578521 Protein (Full Length), N-His tagged | +Inquiry |
fanC-3901E | Recombinant Escherichia coli fanC protein, His-SUMO-tagged | +Inquiry |
MUL1-5806M | Recombinant Mouse MUL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7907EF | Recombinant Full Length Escherichia Coli O9:H4 Protein Psie(Psie) Protein, His-Tagged | +Inquiry |
PVRL2-2080H | Recombinant Human PVRL2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
S100a6-43M | Native Mouse S100A6 | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTB-20HCL | Recombinant Human ACTB cell lysate | +Inquiry |
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
SCG2-788HCL | Recombinant Human SCG2 cell lysate | +Inquiry |
DNASE1L1-6866HCL | Recombinant Human DNASE1L1 293 Cell Lysate | +Inquiry |
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOX Products
Required fields are marked with *
My Review for All TOX Products
Required fields are marked with *
0
Inquiry Basket